Recombinant Human CA6
| Cat.No. : | CA6-26443TH |
| Product Overview : | Recombinant fragment of Human CA6 with a N terminal proprietary tag; Predicted MWt 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | The protein encoded by this gene is one of several isozymes of carbonic anhydrase. This protein is found only in salivary glands and saliva and protein may play a role in the reversible hydratation of carbon dioxide though its function in saliva is unknown. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Tissue specificity : | Major constituent of saliva. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | LQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLHKIEEILDYLRRALN |
| Sequence Similarities : | Belongs to the alpha-carbonic anhydrase family. |
| Gene Name | CA6 carbonic anhydrase VI [ Homo sapiens ] |
| Official Symbol | CA6 |
| Synonyms | CA6; carbonic anhydrase VI; carbonic anhydrase 6; |
| Gene ID | 765 |
| mRNA Refseq | NM_001215 |
| Protein Refseq | NP_001206 |
| MIM | 114780 |
| Uniprot ID | P23280 |
| Chromosome Location | 1p36.2 |
| Pathway | Nitrogen metabolism, organism-specific biosystem; Nitrogen metabolism, conserved biosystem; |
| Function | carbonate dehydratase activity; lyase activity; metal ion binding; zinc ion binding; |
| ◆ Recombinant Proteins | ||
| Car6-826M | Recombinant Mouse Car6 Protein, MYC/DDK-tagged | +Inquiry |
| Car6-7840M | Recombinant Mouse Car6 protein, His-tagged | +Inquiry |
| CA6-613H | Recombinant Human CA6 protein, His&Myc-tagged | +Inquiry |
| CA6-3694H | Recombinant Human CA6 protein, rFc-tagged | +Inquiry |
| CA6-0245H | Recombinant Human CA6 Protein, GST-Tagged | +Inquiry |
| ◆ Native Proteins | ||
| CA6-804H | Native Human CA6 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CA6-266HCL | Recombinant Human CA6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CA6 Products
Required fields are marked with *
My Review for All CA6 Products
Required fields are marked with *




