Recombinant Human CA6 Protein, GST-Tagged
Cat.No. : | CA6-0245H |
Product Overview : | Human CA6 full-length ORF (NP_001206.2, 1 a.a. - 308 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is one of several isozymes of carbonic anhydrase. This protein is found only in salivary glands and saliva and protein may play a role in the reversible hydratation of carbon dioxide though its function in saliva is unknown. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 61.8 kDa |
AA Sequence : | MRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYNPSLKGLNMTGYETQAGEFPMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGASSEISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLHKIEEILDYLRRALN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CA6 carbonic anhydrase VI [ Homo sapiens ] |
Official Symbol | CA6 |
Synonyms | CA6; carbonic anhydrase VI; carbonic anhydrase 6; carbonate dehydratase VI; salivary carbonic anhydrase; secreted carbonic anhydrase; CA-VI; GUSTIN; MGC21256; |
Gene ID | 765 |
mRNA Refseq | NM_001215 |
Protein Refseq | NP_001206 |
MIM | 114780 |
UniProt ID | P23280 |
◆ Recombinant Proteins | ||
CA6-613H | Recombinant Human CA6 protein, His&Myc-tagged | +Inquiry |
CA6-1161M | Recombinant Mouse CA6 Protein, His (Fc)-Avi-tagged | +Inquiry |
CA6-26132TH | Recombinant Human CA6 | +Inquiry |
Car6-826M | Recombinant Mouse Car6 Protein, MYC/DDK-tagged | +Inquiry |
Car6-7840M | Recombinant Mouse Car6 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CA6-804H | Native Human CA6 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CA6-266HCL | Recombinant Human CA6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CA6 Products
Required fields are marked with *
My Review for All CA6 Products
Required fields are marked with *