Recombinant Human CA6 Protein, GST-Tagged

• Cat.No.: CA6-0245H
• Product Overview: Human CA6 full-length ORF (NP_001206.2, 1 a.a. - 308 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is one of several isozymes of carbonic anhydrase. This protein is found only in salivary glands and saliva and protein may play a role in the reversible hydratation of carbon dioxide though its function in saliva is unknown. [provided by RefSeq, Jul 2008]
• Molecular Mass: 61.8 kDa
• AA Sequence: MRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYNPSLKGLNMTGYETQAGEFPMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGASSEISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLHKIEEILDYLRRALN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CA6 carbonic anhydrase VI [ Homo sapiens ]
• Official Symbol: CA6
• Synonyms: CA6; carbonic anhydrase VI; carbonic anhydrase 6; carbonate dehydratase VI; salivary carbonic anhydrase; secreted carbonic anhydrase; CA-VI; GUSTIN; MGC21256
• Gene ID: 765
• mRNA Refseq: NM_001215
• Protein Refseq: NP_001206
• MIM: 114780
• UniProt ID: P23280