Recombinant Human CA6 Protein, GST-Tagged
| Cat.No. : | CA6-0245H |
| Product Overview : | Human CA6 full-length ORF (NP_001206.2, 1 a.a. - 308 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is one of several isozymes of carbonic anhydrase. This protein is found only in salivary glands and saliva and protein may play a role in the reversible hydratation of carbon dioxide though its function in saliva is unknown. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 61.8 kDa |
| AA Sequence : | MRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYNPSLKGLNMTGYETQAGEFPMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGASSEISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLHKIEEILDYLRRALN |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CA6 carbonic anhydrase VI [ Homo sapiens ] |
| Official Symbol | CA6 |
| Synonyms | CA6; carbonic anhydrase VI; carbonic anhydrase 6; carbonate dehydratase VI; salivary carbonic anhydrase; secreted carbonic anhydrase; CA-VI; GUSTIN; MGC21256; |
| Gene ID | 765 |
| mRNA Refseq | NM_001215 |
| Protein Refseq | NP_001206 |
| MIM | 114780 |
| UniProt ID | P23280 |
| ◆ Recombinant Proteins | ||
| CA6-0245H | Recombinant Human CA6 Protein, GST-Tagged | +Inquiry |
| Car6-826M | Recombinant Mouse Car6 Protein, MYC/DDK-tagged | +Inquiry |
| CA6-350H | Recombinant Human CA6 Protein, His&GST-tagged | +Inquiry |
| CA6-527H | Active Recombinant Human CA6, His-tagged | +Inquiry |
| CA6-45HF | Recombinant Full Length Human CA6 Protein | +Inquiry |
| ◆ Native Proteins | ||
| CA6-804H | Native Human CA6 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CA6-266HCL | Recombinant Human CA6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CA6 Products
Required fields are marked with *
My Review for All CA6 Products
Required fields are marked with *
