"CRHR1" Related Products

Expand
Expand

Recombinant Human CRHR1

Cat.No.: CRHR1-27818TH
Product Overview: Recombinant fragment: SLQDQHCESL SLASNISGLQ CNASVDLIGT CWPRSPAGQL VVRPCPAFFY GVRYNTTNNG YRECLANGSW AARVNYSECQ EILNEEKKSK VHYHVAVI corresponding to amino acids 24-121 of Human CRF1 with an N terminal proprietary tag; Predicted MWt 36.41 kDa.
Description: This gene encodes a G-protein coupled receptor that binds neuropeptides of the corticotropin releasing hormone family that are major regulators of the hypothalamic-pituitary-adrenal pathway. The encoded protein is essential for the activation of signal transduction pathways that regulate diverse physiological processes including stress, reproduction, immune response and obesity. Alternative splicing results in multiple transcript variants one of which is a non-coding read-through transcript with the neighboring gene MGC57346.
Protein length: 98 amino acids
Molecular Weight: 36.410kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Predominantly expressed in the cerebellum, pituitary, cerebral cortex and olfactory lobe.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: SLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAVI
Sequence Similarities: Belongs to the G-protein coupled receptor 2 family.
Gene Name: CRHR1 corticotropin releasing hormone receptor 1 [ Homo sapiens ]
Official Symbol: CRHR1
Synonyms: CRHR1; corticotropin releasing hormone receptor 1; CRHR; corticotropin-releasing factor receptor 1; corticotropin releasing factor receptor; CRF R; CRF1;
Gene ID: 1394
mRNA Refseq: NM_004382
Protein Refseq: NP_004373
MIM: 122561
Uniprot ID: P34998
Chromosome Location: 17q12-q22
Pathway: Class B/2 (Secretin family receptors), organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class B Secretin-like, organism-specific biosystem;
Function: corticotrophin-releasing factor receptor activity; corticotropin-releasing hormone binding; peptide binding; protein binding; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.