Recombinant Human CRHR1
| Cat.No. : | CRHR1-27818TH |
| Product Overview : | Recombinant fragment: SLQDQHCESL SLASNISGLQ CNASVDLIGT CWPRSPAGQL VVRPCPAFFY GVRYNTTNNG YRECLANGSW AARVNYSECQ EILNEEKKSK VHYHVAVI corresponding to amino acids 24-121 of Human CRF1 with an N terminal proprietary tag; Predicted MWt 36.41 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 98 amino acids |
| Description : | This gene encodes a G-protein coupled receptor that binds neuropeptides of the corticotropin releasing hormone family that are major regulators of the hypothalamic-pituitary-adrenal pathway. The encoded protein is essential for the activation of signal transduction pathways that regulate diverse physiological processes including stress, reproduction, immune response and obesity. Alternative splicing results in multiple transcript variants one of which is a non-coding read-through transcript with the neighboring gene MGC57346. |
| Molecular Weight : | 36.410kDa inclusive of tags |
| Tissue specificity : | Predominantly expressed in the cerebellum, pituitary, cerebral cortex and olfactory lobe. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | SLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAVI |
| Sequence Similarities : | Belongs to the G-protein coupled receptor 2 family. |
| Gene Name | CRHR1 corticotropin releasing hormone receptor 1 [ Homo sapiens ] |
| Official Symbol | CRHR1 |
| Synonyms | CRHR1; corticotropin releasing hormone receptor 1; CRHR; corticotropin-releasing factor receptor 1; corticotropin releasing factor receptor; CRF R; CRF1; |
| Gene ID | 1394 |
| mRNA Refseq | NM_004382 |
| Protein Refseq | NP_004373 |
| MIM | 122561 |
| Uniprot ID | P34998 |
| Chromosome Location | 17q12-q22 |
| Pathway | Class B/2 (Secretin family receptors), organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class B Secretin-like, organism-specific biosystem; |
| Function | corticotrophin-releasing factor receptor activity; corticotropin-releasing hormone binding; peptide binding; protein binding; receptor activity; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRHR1 Products
Required fields are marked with *
My Review for All CRHR1 Products
Required fields are marked with *
