Native Human CXCL9

PRODUCTS

Home / Products / Native Human CXCL9

Native Human CXCL9

CXCL9 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CXCL9-30233TH
Product Overview : Human MIG.
Description : The function of this gene has not been specifically defined; however, it is thought to be involved in T cell trafficking. This gene has been localized to 4q21 with INP10, which is also a member of the chemokine family of cytokines.
Source : E. coli
Form : Lyophilised
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : Human MIG is an 11.7 kDa protein containing 103 amino acid residues:TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLK NGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKH QKKKVLKVRKSQRSRQKKTT
Sequence Similarities : Belongs to the intercrine alpha (chemokine CxC) family.
Gene Name : CXCL9 chemokine (C-X-C motif) ligand 9 [ Homo sapiens ]
Official Symbol : CXCL9
Synonyms : CXCL9; chemokine (C-X-C motif) ligand 9; CMK, MIG, monokine induced by gamma interferon; C-X-C motif chemokine 9; crg 10; Humig; SCYB9;
Gene ID : 4283
mRNA Refseq : NM_002416
Protein Refseq : NP_002407
MIM : 601704
Uniprot ID : Q07325
Chromosome Location : 4q21
Pathway : CXCR3-mediated signaling events, organism-specific biosystem; Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem;
Function : chemokine activity; cytokine activity;

Online Inquiry


  •  
  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.