"CXCL9" Related Products

Expand
Expand
Expand

Native Human CXCL9

Cat.No.: CXCL9-30233TH
Product Overview: Human MIG.
Description: The function of this gene has not been specifically defined; however, it is thought to be involved in T cell trafficking. This gene has been localized to 4q21 with INP10, which is also a member of the chemokine family of cytokines.
Source: E. coli
Form: Lyophilised
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: Human MIG is an 11.7 kDa protein containing 103 amino acid residues:TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLK NGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKH QKKKVLKVRKSQRSRQKKTT
Sequence Similarities: Belongs to the intercrine alpha (chemokine CxC) family.
Gene Name: CXCL9 chemokine (C-X-C motif) ligand 9 [ Homo sapiens ]
Official Symbol: CXCL9
Synonyms: CXCL9; chemokine (C-X-C motif) ligand 9; CMK, MIG, monokine induced by gamma interferon; C-X-C motif chemokine 9; crg 10; Humig; SCYB9;
Gene ID: 4283
mRNA Refseq: NM_002416
Protein Refseq: NP_002407
MIM: 601704
Uniprot ID: Q07325
Chromosome Location: 4q21
Pathway: CXCR3-mediated signaling events, organism-specific biosystem; Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem;
Function: chemokine activity; cytokine activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.