Recombinant Human DNMT3A, His-tagged DNMT3A-26885TH

Recombinant Human DNMT3A, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human DNMT3A, His-tagged

Recombinant Human DNMT3A, His-tagged

DNMT3A Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : DNMT3A-26885TH
Product Overview : Recombinant fragment, corresponding to amino acids 269-546 (278 amino acids) of Human Dnmt3a (Isoform b) with N terminal His tag; MWt 32kDa.
Description : CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a DNA methyltransferase that is thought to function in de novo methylation, rather than maintenance methylation. The protein localizes to the cytoplasm and nucleus and its expression is developmentally regulated. Alternative splicing results in multiple transcript variants encoding different isoforms.
Conjugation : HIS
Source : E. coli
Tissue specificity : Highly expressed in fetal tissues, skeletal muscle, heart, peripheral blood mononuclear cells, kidney, and at lower levels in placenta, brain, liver, colon, spleen, small intestine and lung.
Form : Lyophilised:Reconstitute with 136 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : RKSTAEKPKVKEIIDERTRERLVYEVRQKCRNIEDICISC GSLNVTLEHPLFVGGMCQNCKNCFLECAYQYDDDGYQS YCTICCGGREVLMCGNNNCCRCFCVECVDLLVGPGAAQ AAIKEDPWNCYMCGHKGTYGLLRRREDWPSRLQMFFAN NHDQEFDPPKVYPPVPAEKRKPIRVLSLFDGIATGLLVLK DLGIQVDRYIASEVCEDSITVGMVRHQGKIMYVGDVRS VTQKHIQEWGPFDLVIGGSPCNDLSIVNPARKGLYEGT GRLFFEFY
Sequence Similarities : Belongs to the C5-methyltransferase family.Contains 1 ADD domain.Contains 1 GATA-type zinc finger.Contains 1 PHD-type zinc finger.Contains 1 PWWP domain.
Gene Name : DNMT3A DNA (cytosine-5-)-methyltransferase 3 alpha [ Homo sapiens ]
Official Symbol : DNMT3A
Synonyms : DNMT3A; DNA (cytosine-5-)-methyltransferase 3 alpha; DNA (cytosine-5)-methyltransferase 3A;
Gene ID : 1788
mRNA Refseq : NM_022552
Protein Refseq : NP_072046
MIM : 602769
Uniprot ID : Q9Y6K1
Chromosome Location : 2p23
Pathway : Cysteine and methionine metabolism, organism-specific biosystem; Cysteine and methionine metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; Methionine degradation, organism-specific biosystem; Methionine degradation, conserved biosystem;
Function : DNA (cytosine-5-)-methyltransferase activity; DNA (cytosine-5-)-methyltransferase activity, acting on CpG substrates; DNA binding; chromatin binding; metal ion binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy