Recombinant Human DNMT3A, His-tagged
| Cat.No. : | DNMT3A-26885TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 269-546 (278 amino acids) of Human Dnmt3a (Isoform b) with N terminal His tag; MWt 32kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 269-546 a.a. |
| Description : | CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a DNA methyltransferase that is thought to function in de novo methylation, rather than maintenance methylation. The protein localizes to the cytoplasm and nucleus and its expression is developmentally regulated. Alternative splicing results in multiple transcript variants encoding different isoforms. |
| Conjugation : | HIS |
| Tissue specificity : | Highly expressed in fetal tissues, skeletal muscle, heart, peripheral blood mononuclear cells, kidney, and at lower levels in placenta, brain, liver, colon, spleen, small intestine and lung. |
| Form : | Lyophilised:Reconstitute with 136 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | RKSTAEKPKVKEIIDERTRERLVYEVRQKCRNIEDICISC GSLNVTLEHPLFVGGMCQNCKNCFLECAYQYDDDGYQS YCTICCGGREVLMCGNNNCCRCFCVECVDLLVGPGAAQ AAIKEDPWNCYMCGHKGTYGLLRRREDWPSRLQMFFAN NHDQEFDPPKVYPPVPAEKRKPIRVLSLFDGIATGLLVLK DLGIQVDRYIASEVCEDSITVGMVRHQGKIMYVGDVRS VTQKHIQEWGPFDLVIGGSPCNDLSIVNPARKGLYEGT GRLFFEFY |
| Sequence Similarities : | Belongs to the C5-methyltransferase family.Contains 1 ADD domain.Contains 1 GATA-type zinc finger.Contains 1 PHD-type zinc finger.Contains 1 PWWP domain. |
| Gene Name | DNMT3A DNA (cytosine-5-)-methyltransferase 3 alpha [ Homo sapiens ] |
| Official Symbol | DNMT3A |
| Synonyms | DNMT3A; DNA (cytosine-5-)-methyltransferase 3 alpha; DNA (cytosine-5)-methyltransferase 3A; |
| Gene ID | 1788 |
| mRNA Refseq | NM_022552 |
| Protein Refseq | NP_072046 |
| MIM | 602769 |
| Uniprot ID | Q9Y6K1 |
| Chromosome Location | 2p23 |
| Pathway | Cysteine and methionine metabolism, organism-specific biosystem; Cysteine and methionine metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; Methionine degradation, organism-specific biosystem; Methionine degradation, conserved biosystem; |
| Function | DNA (cytosine-5-)-methyltransferase activity; DNA (cytosine-5-)-methyltransferase activity, acting on CpG substrates; DNA binding; chromatin binding; metal ion binding; |
| ◆ Recombinant Proteins | ||
| DNMT3A-01HFL | Active Recombinant Full Length Human DNMT3A Protein, Flag-tagged | +Inquiry |
| Dnmt3a-2621M | Recombinant Mouse Dnmt3a Protein, Myc/DDK-tagged | +Inquiry |
| DNMT3A-4049HF | Recombinant Full Length Human DNMT3A Protein, GST-tagged | +Inquiry |
| DNMT3A-20H | Recombinant Human DNMT3A, His-tagged | +Inquiry |
| DNMT3A-26885TH | Recombinant Human DNMT3A, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DNMT3A-6855HCL | Recombinant Human DNMT3A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNMT3A Products
Required fields are marked with *
My Review for All DNMT3A Products
Required fields are marked with *



