Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human DNMT3A, His-tagged

Cat.No. : DNMT3A-26885TH
Product Overview : Recombinant fragment, corresponding to amino acids 269-546 (278 amino acids) of Human Dnmt3a (Isoform b) with N terminal His tag; MWt 32kDa.
  • Specification
  • Gene Information
  • Related Products
Description : CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a DNA methyltransferase that is thought to function in de novo methylation, rather than maintenance methylation. The protein localizes to the cytoplasm and nucleus and its expression is developmentally regulated. Alternative splicing results in multiple transcript variants encoding different isoforms.
Conjugation : HIS
Source : E. coli
Tissue specificity : Highly expressed in fetal tissues, skeletal muscle, heart, peripheral blood mononuclear cells, kidney, and at lower levels in placenta, brain, liver, colon, spleen, small intestine and lung.
Form : Lyophilised:Reconstitute with 136 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : RKSTAEKPKVKEIIDERTRERLVYEVRQKCRNIEDICISC GSLNVTLEHPLFVGGMCQNCKNCFLECAYQYDDDGYQS YCTICCGGREVLMCGNNNCCRCFCVECVDLLVGPGAAQ AAIKEDPWNCYMCGHKGTYGLLRRREDWPSRLQMFFAN NHDQEFDPPKVYPPVPAEKRKPIRVLSLFDGIATGLLVLK DLGIQVDRYIASEVCEDSITVGMVRHQGKIMYVGDVRS VTQKHIQEWGPFDLVIGGSPCNDLSIVNPARKGLYEGT GRLFFEFY
Sequence Similarities : Belongs to the C5-methyltransferase family.Contains 1 ADD domain.Contains 1 GATA-type zinc finger.Contains 1 PHD-type zinc finger.Contains 1 PWWP domain.
Gene Name : DNMT3A DNA (cytosine-5-)-methyltransferase 3 alpha [ Homo sapiens ]
Official Symbol : DNMT3A
Synonyms : DNMT3A; DNA (cytosine-5-)-methyltransferase 3 alpha; DNA (cytosine-5)-methyltransferase 3A;
Gene ID : 1788
mRNA Refseq : NM_022552
Protein Refseq : NP_072046
MIM : 602769
Uniprot ID : Q9Y6K1
Chromosome Location : 2p23
Pathway : Cysteine and methionine metabolism, organism-specific biosystem; Cysteine and methionine metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; Methionine degradation, organism-specific biosystem; Methionine degradation, conserved biosystem;
Function : DNA (cytosine-5-)-methyltransferase activity; DNA (cytosine-5-)-methyltransferase activity, acting on CpG substrates; DNA binding; chromatin binding; metal ion binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends