"EIF2S3" Related Products

Recombinant Human EIF2S3

Cat.No.: EIF2S3-28379TH
Product Overview: Recombinant fragment of Human EIF2G with N-terminal proprietary tag.Mol Wt 35.53 kDa inclusive of tag.
Description: The protein encoded by this gene is the largest subunit of a heterotrimeric GTP-binding protein involved in the recruitment of methionyl-tRNA(i) to the 40 S ribosomal subunit.
Protein length: 90 amino acids
Molecular Weight: 35.530kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: GVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAVKADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD
Sequence Similarities: Belongs to the GTP-binding elongation factor family. EIF2G subfamily.
Gene Name: EIF2S3 eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa [ Homo sapiens ]
Official Symbol: EIF2S3
Synonyms: EIF2S3; eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa; EIF2G, eukaryotic translation initiation factor 2, subunit 3 (gamma, 52kD); eukaryotic translation initiation factor 2 subunit 3; EIF2; EIF2gamma; eukaryotic translation initiati
Gene ID: 1968
mRNA Refseq: NM_001415
Protein Refseq: NP_001406
MIM: 300161
Uniprot ID: P41091
Chromosome Location: Xp22.2-p22.1
Pathway: Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S, organism-specific biosystem; Cap-dependent Translation Initiation, organism-specific biosystem; Eukaryotic Translation Initiation, organism-specific biosystem; Formation of the ternary complex, and subsequently, the 43S complex, organism-specific biosystem; GTP hydrolysis and joining of the 60S ribosomal subunit, organism-specific biosystem;
Function: GTP binding; GTPase activity; nucleotide binding; protein binding; translation factor activity, nucleic acid binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.