Recombinant Human EIF2S3

• Cat.No.: EIF2S3-28379TH
• Product Overview: Recombinant fragment of Human EIF2G with N-terminal proprietary tag.Mol Wt 35.53 kDa inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 90 amino acids
• Description: The protein encoded by this gene is the largest subunit of a heterotrimeric GTP-binding protein involved in the recruitment of methionyl-tRNA(i) to the 40 S ribosomal subunit.
• Molecular Weight: 35.530kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: GVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAVKADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD
• Sequence Similarities: Belongs to the GTP-binding elongation factor family. EIF2G subfamily.

Gene Information

• Gene Name: EIF2S3 eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa [ Homo sapiens ]
• Official Symbol: EIF2S3
• Synonyms: EIF2S3; eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa; EIF2G, eukaryotic translation initiation factor 2, subunit 3 (gamma, 52kD); eukaryotic translation initiation factor 2 subunit 3; EIF2; EIF2gamma; eukaryotic translation initiati
• Gene ID: 1968
• mRNA Refseq: NM_001415
• Protein Refseq: NP_001406
• MIM: 300161
• Uniprot ID: P41091
• Chromosome Location: Xp22.2-p22.1
• Pathway: Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S, organism-specific biosystem; Cap-dependent Translation Initiation, organism-specific biosystem; Eukaryotic Translation Initiation, organism-specific biosystem; Formation of the ternary complex, and subsequently, the 43S complex, organism-specific biosystem; GTP hydrolysis and joining of the 60S ribosomal subunit, organism-specific biosystem
• Function: GTP binding; GTPase activity; nucleotide binding; protein binding; translation factor activity, nucleic acid binding