Recombinant Human EIF2S3
Cat.No. : | EIF2S3-28379TH |
Product Overview : | Recombinant fragment of Human EIF2G with N-terminal proprietary tag.Mol Wt 35.53 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 90 amino acids |
Description : | The protein encoded by this gene is the largest subunit of a heterotrimeric GTP-binding protein involved in the recruitment of methionyl-tRNA(i) to the 40 S ribosomal subunit. |
Molecular Weight : | 35.530kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAVKADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD |
Sequence Similarities : | Belongs to the GTP-binding elongation factor family. EIF2G subfamily. |
Gene Name | EIF2S3 eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa [ Homo sapiens ] |
Official Symbol | EIF2S3 |
Synonyms | EIF2S3; eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa; EIF2G, eukaryotic translation initiation factor 2, subunit 3 (gamma, 52kD); eukaryotic translation initiation factor 2 subunit 3; EIF2; EIF2gamma; eukaryotic translation initiati |
Gene ID | 1968 |
mRNA Refseq | NM_001415 |
Protein Refseq | NP_001406 |
MIM | 300161 |
Uniprot ID | P41091 |
Chromosome Location | Xp22.2-p22.1 |
Pathway | Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S, organism-specific biosystem; Cap-dependent Translation Initiation, organism-specific biosystem; Eukaryotic Translation Initiation, organism-specific biosystem; Formation of the ternary complex, and subsequently, the 43S complex, organism-specific biosystem; GTP hydrolysis and joining of the 60S ribosomal subunit, organism-specific biosystem; |
Function | GTP binding; GTPase activity; nucleotide binding; protein binding; translation factor activity, nucleic acid binding; |
◆ Recombinant Proteins | ||
EIF2S3-3175H | Recombinant Human EIF2S3 Protein, GST-tagged | +Inquiry |
EIF2S3-28379TH | Recombinant Human EIF2S3 | +Inquiry |
EIF2S3-4198HF | Recombinant Full Length Human EIF2S3 Protein, GST-tagged | +Inquiry |
EIF2S3-1407C | Recombinant Chicken EIF2S3 | +Inquiry |
EIF2S3-11986Z | Recombinant Zebrafish EIF2S3 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF2S3 Products
Required fields are marked with *
My Review for All EIF2S3 Products
Required fields are marked with *