Recombinant Human EIF2S3 Protein, GST-tagged
Cat.No. : | EIF2S3-3175H |
Product Overview : | Human EIF2S3 full-length ORF ( NP_001406.1, 1 a.a. - 472 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is the largest subunit of a heterotrimeric GTP-binding protein involved in the recruitment of methionyl-tRNA(i) to the 40 S ribosomal subunit. [provided by RefSeq, Jan 2010] |
Molecular Mass : | 77.5 kDa |
AA Sequence : | MAGGEAGVTLGQPHLSRQDLTTLDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKAISGVHTVRFKNELERNITIKLGYANAKIYKLDDPSCPRPECYRSCGSSTPDEFPTDIPGTKGNFKLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIMKLKHILILQNKIDLVKESQAKEQYEQILAFVQGTVAEGAPIIPISAQLKYNIEVVCEYIVKKIPVPPRDFTSEPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILKGVLKVGQEIEVRPGIVSKDSEGKLMCKPIFSKIVSLFAEHNDLQYAAPGGLIGVGTKIDPTLCRADRMVGQVLGAVGALPEIFTELEISYFLLRRLLGVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAVKADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EIF2S3 eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa [ Homo sapiens ] |
Official Symbol | EIF2S3 |
Synonyms | EIF2S3; eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa; EIF2G, eukaryotic translation initiation factor 2, subunit 3 (gamma, 52kD); eukaryotic translation initiation factor 2 subunit 3; EIF2; EIF2gamma; eukaryotic translation initiation factor 2G; eIF-2gX; eIF-2-gamma X; eukaryotic translation initiation factor 2 subunit gamma X; EIF2G; eIF-2gA; |
Gene ID | 1968 |
mRNA Refseq | NM_001415 |
Protein Refseq | NP_001406 |
MIM | 300161 |
UniProt ID | P41091 |
◆ Recombinant Proteins | ||
EIF2S3-4198HF | Recombinant Full Length Human EIF2S3 Protein, GST-tagged | +Inquiry |
EIF2S3-11986Z | Recombinant Zebrafish EIF2S3 | +Inquiry |
EIF2S3-28379TH | Recombinant Human EIF2S3 | +Inquiry |
EIF2S3-1407C | Recombinant Chicken EIF2S3 | +Inquiry |
EIF2S3-3175H | Recombinant Human EIF2S3 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EIF2S3 Products
Required fields are marked with *
My Review for All EIF2S3 Products
Required fields are marked with *
0
Inquiry Basket