"F2R" Related Products

Expand
Expand

Recombinant Human F2R

Cat.No.: F2R-31176TH
Product Overview: Recombinant fragment corresponding to amino acids 42-102 of Human Thrombin Receptor with an N terminal proprietary tag; Predicted MWt 32.34 kDa.
Description: Coagulation factor II receptor is a 7-transmembrane receptor involved in the regulation of thrombotic response.Proteolytic cleavage leads to the activation of the receptor.F2R is a G-protein coupled receptor family member.
Protein length: 61 amino acids
Molecular Weight: 32.340kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Platelets and vascular endothelial cells.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: SFLLRNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLT
Sequence Similarities: Belongs to the G-protein coupled receptor 1 family.
Gene Name: F2R coagulation factor II (thrombin) receptor [ Homo sapiens ]
Official Symbol: F2R
Synonyms: F2R; coagulation factor II (thrombin) receptor; proteinase-activated receptor 1; CF2R; PAR 1; PAR1; TR;
Gene ID: 2149
mRNA Refseq: NM_001992
Protein Refseq: NP_001983
MIM: 187930
Uniprot ID: P25116
Chromosome Location: 5q13
Pathway: Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Complement and Coagulation Cascades, organism-specific biosystem; Complement and coagulation cascades, organism-specific biosystem;
Function: G-protein alpha-subunit binding; G-protein beta-subunit binding; G-protein coupled receptor activity; G-protein coupled receptor activity; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.