"GRIA1" Related Products

Expand
Expand

Recombinant Human GRIA1

Cat.No.: GRIA1-29069TH
Product Overview: Recombinant fragment corresponding to amino acids 201-300 of Human Glutamate Receptor 1 with a proprietary tag; Predicted MWt 36.63.
Description: Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. These receptors are heteromeric protein complexes with multiple subunits, each possessing transmembrane regions, and all arranged to form a ligand-gated ion channel. The classification of glutamate receptors is based on their activation by different pharmacologic agonists. This gene belongs to a family of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate (AMPA) receptors. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Widely expressed in brain.
Biological activity: useful for Antibody Production and Protein Array
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: VVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVM
Sequence Similarities: Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRIA1 subfamily.
Gene Name: GRIA1 glutamate receptor, ionotropic, AMPA 1 [ Homo sapiens ]
Official Symbol: GRIA1
Synonyms: GRIA1; glutamate receptor, ionotropic, AMPA 1; GLUR1; glutamate receptor 1; GLURA;
Gene ID: 2890
mRNA Refseq: NM_000827
Protein Refseq: NP_000818
MIM: 138248
Uniprot ID: P42261
Chromosome Location: 5q33
Pathway: Activation of AMPA receptors, organism-specific biosystem; Activation of NMDA receptor upon glutamate binding and postsynaptic events, organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem; Dopaminergic synapse, organism-specific biosystem;
Function: PDZ domain binding; alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity; extracellular-glutamate-gated ion channel activity; glutamate receptor activity; ion channel activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.