Recombinant Human MAGEA6

PRODUCTS

Home / Products / Recombinant Human MAGEA6

Recombinant Human MAGEA6

MAGEA6 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : MAGEA6-30166TH
Product Overview : Recombinant full length Human MAGEA6 with a N terminal proprietary tag; Predicted MWt 60.61 kDa including the tag.
Description : This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Two transcript variants encoding the same protein have been identified for this gene.
Protein length : 314 amino acids
Molecular Weight : 60.610kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Expressed in many tumors of several types, such as melanoma, head and neck squamous cell carcinoma, lung carcinoma and breast carcinoma, but not in normal tissues except for testes.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQEAAS SSSTLVEVTLGEVPAAESPDPPQSPQGASSLPTTMNYPLW SQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVAKLVHFL LLKYRAREPVTKAEMLGSVVGNWQYFFPVIFSKASDSLQL VFGIELMEVDPIGHVYIFATCLGLSYDGLLGDNQIMPKTG FLIIILAIIAKEGDCAPEEKIWEELSVLEVFEGREDSIFG DPKKLLTQYFVQENYLEYRQVPGSDPACYEFLWGPRALIE TSYVKVLHHMVKISGGPRISYPLLHEWALREGEE
Sequence Similarities : Contains 1 MAGE domain.
Gene Name : MAGEA6 melanoma antigen family A, 6 [ Homo sapiens ]
Official Symbol : MAGEA6
Synonyms : MAGEA6; melanoma antigen family A, 6; MAGE6; melanoma-associated antigen 6; cancer/testis antigen family 1; member 6; CT1.6; MAGE 6 antigen; melanoma antigen family A 6; melanoma associated antigen 6;
Gene ID : 4105
mRNA Refseq : NM_005363
Protein Refseq : NP_005354
MIM : 300176
Uniprot ID : P43360
Chromosome Location : Xq28
Function : molecular_function;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.