"NFATC2" Related Products

Recombinant Human NFATC2, His-tagged

Cat.No.: NFATC2-29251TH
Product Overview: Recombinant fragment, corresponding to amino acids 320-849 (530 amino acids) of Human NFAT1 with an N terminal His tag. Predicted mwt: 60 kDa;
Description: This gene is a member of the nuclear factor of activated T cells (NFAT) family. The product of this gene is a DNA-binding protein with a REL-homology region (RHR) and an NFAT-homology region (NHR). This protein is present in the cytosol and only translocates to the nucleus upon T cell receptor (TCR) stimulation, where it becomes a member of the nuclear factors of activated T cells transcription complex. This complex plays a central role in inducing gene transcription during the immune response. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Conjugation: HIS
Source: E. coli
Tissue specificity: Expressed in thymus, spleen, heart, testis, brain, placenta, muscle and pancreas.
Form: Lyophilised:Reconstitute with 85 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: GLPRHIYPAVEFLGPCEQGERRNSAPESILLVPPTWPKPL VPAIPICSIPVTASLPPLEWPLSSQSGSYELRIEVQPK PHHRAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLG LQIFIGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGN TKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGET DIGRKNTRVRLVFRVHIPESSGRIVSLQTASNPIECSQ RSAHELPMVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPEYRNKH IRTPVKVNFYVINGKRKRSQPQHFTYHPVPAIKTEPTD EYDPTLICSPTHGGLGSQPYYPQHPMVAESPSCLVATM APCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGY QQPALMAAPLSLADAHRSVLVHAGSQGQSSALLHPSPT NQQASPVIHYSPTNQQLRCGSHQEFQHIMYCENFAPGT TRPGPPPVSQGQRLSPGSYPTVIQQQNA
Sequence Similarities: Contains 1 RHD (Rel-like) domain.
Gene Name: NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 [ Homo sapiens ]
Official Symbol: NFATC2
Synonyms: NFATC2; nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2; nuclear factor of activated T-cells, cytoplasmic 2; NF ATP; NFAT1; NFATp;
Gene ID: 4773
mRNA Refseq: NM_001136021
Protein Refseq: NP_001129493
MIM: 600490
Uniprot ID: Q13469
Chromosome Location: 20q13.2
Pathway: Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; B cell receptor signaling pathway, organism-specific biosystem; B cell receptor signaling pathway, conserved biosystem;
Function: DNA binding; protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription regulatory region DNA binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.