Recombinant Human NFATC2, His-tagged
Cat.No. : | NFATC2-29251TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 320-849 (530 amino acids) of Human NFAT1 with an N terminal His tag. Predicted mwt: 60 kDa; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 320-849 a.a. |
Description : | This gene is a member of the nuclear factor of activated T cells (NFAT) family. The product of this gene is a DNA-binding protein with a REL-homology region (RHR) and an NFAT-homology region (NHR). This protein is present in the cytosol and only translocates to the nucleus upon T cell receptor (TCR) stimulation, where it becomes a member of the nuclear factors of activated T cells transcription complex. This complex plays a central role in inducing gene transcription during the immune response. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
Conjugation : | HIS |
Tissue specificity : | Expressed in thymus, spleen, heart, testis, brain, placenta, muscle and pancreas. |
Form : | Lyophilised:Reconstitute with 85 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GLPRHIYPAVEFLGPCEQGERRNSAPESILLVPPTWPKPL VPAIPICSIPVTASLPPLEWPLSSQSGSYELRIEVQPK PHHRAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLG LQIFIGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGN TKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGET DIGRKNTRVRLVFRVHIPESSGRIVSLQTASNPIECSQ RSAHELPMVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPEYRNKH IRTPVKVNFYVINGKRKRSQPQHFTYHPVPAIKTEPTD EYDPTLICSPTHGGLGSQPYYPQHPMVAESPSCLVATM APCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGY QQPALMAAPLSLADAHRSVLVHAGSQGQSSALLHPSPT NQQASPVIHYSPTNQQLRCGSHQEFQHIMYCENFAPGT TRPGPPPVSQGQRLSPGSYPTVIQQQNA |
Sequence Similarities : | Contains 1 RHD (Rel-like) domain. |
Gene Name | NFATC2 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 [ Homo sapiens ] |
Official Symbol | NFATC2 |
Synonyms | NFATC2; nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2; nuclear factor of activated T-cells, cytoplasmic 2; NF ATP; NFAT1; NFATp; |
Gene ID | 4773 |
mRNA Refseq | NM_001136021 |
Protein Refseq | NP_001129493 |
MIM | 600490 |
Uniprot ID | Q13469 |
Chromosome Location | 20q13.2 |
Pathway | Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; B cell receptor signaling pathway, organism-specific biosystem; B cell receptor signaling pathway, conserved biosystem; |
Function | DNA binding; protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription regulatory region DNA binding; |
◆ Recombinant Proteins | ||
NFATC2-29251TH | Recombinant Human NFATC2, His-tagged | +Inquiry |
Nfatc2-4388M | Recombinant Mouse Nfatc2 Protein, Myc/DDK-tagged | +Inquiry |
NFATC2-2740HFL | Recombinant Full Length Human NFATC2 protein, Flag-tagged | +Inquiry |
NFATC2-3619H | Recombinant Human NFATC2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NFATC2-181H | Recombinant Human NFATC2 protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NFATC2 Products
Required fields are marked with *
My Review for All NFATC2 Products
Required fields are marked with *
0
Inquiry Basket