Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human SP1, His-tagged

Cat.No. : SP1-30987TH
Product Overview : Recombinant fragment, corresponding to amino acids 645-778 of Human SP1 with N terminal His tag; 134 amino acids, 17kDa.
  • Specification
  • Gene Information
  • Related Products
Description : The protein encoded by this gene is a zinc finger transcription factor that binds to GC-rich motifs of many promoters. The encoded protein is involved in many cellular processes, including cell differentiation, cell growth, apoptosis, immune responses, response to DNA damage, and chromatin remodeling. Post-translational modifications such as phosphorylation, acetylation, glycosylation, and proteolytic processing significantly affect the activity of this protein, which can be an activator or a repressor. Three transcript variants encoding different isoforms have been found for this gene.
Conjugation : HIS
Source : E. coli
Tissue specificity : Up-regulated in adenocarcinomas of the stomach (at protein level).
Form : Lyophilised:Reconstitute with 148 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Store at 4°C. Upon reconstitution store at -80oC.
Sequences of amino acids : GERPFMCTWSYCGKRFTRSDELQRHKRTHTGEKKFACPEC PKRFMRSDHLSKHIKTHQNKKGGPGVALSVGTLPLDSG AGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINV MQVADLQSINISGNGF
Sequence Similarities : Belongs to the Sp1 C2H2-type zinc-finger protein family.Contains 3 C2H2-type zinc fingers.
Gene Name : SP1 Sp1 transcription factor [ Homo sapiens ]
Official Symbol : SP1
Synonyms : SP1; Sp1 transcription factor; transcription factor Sp1; specificity protein 1;
Gene ID : 6667
mRNA Refseq : NM_001251825
Protein Refseq : NP_001238754
MIM : 189906
Uniprot ID : P08047
Chromosome Location : 12q13.1
Pathway : Adipogenesis, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; C-MYB transcription factor network, organism-specific biosystem; Direct p53 effectors, organism-specific biosystem; E2F transcription factor network, organism-specific biosystem;
Function : DNA binding; HMG box domain binding; double-stranded DNA binding; enhancer binding; histone acetyltransferase binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends