"USP7" Related Products

Expand
Expand
Expand

Recombinant Human USP7, His-tagged

Cat.No.: USP7-29182TH
Product Overview: Recombinant fragment, corresponding to amino acids 907-1102 of Human HAUSP / USP7 with N terminal His tag; 196 amino acids, 29kDa.
Description: Ubiquitin-specific-processing protease 7 (USP7) also known as ubiquitin carboxyl-terminal hydrolase 7 or herpesvirus-associated ubiquitin-specific protease (HAUSP) is an enzyme that in humans is encoded by the USP7 gene.
Conjugation: HIS
Source: E. coli
Tissue specificity: Widely expressed. Overexpressed in prostate cancer.
Form: Lyophilised:Reconstitute with 146 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium hydrogen phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: EITLYPDKHGCVRDLLEECKKAVELGEKASGKLRLLEIVS YKIIGVHQEDELLECLSPATSRTFRIEEIPLDQVDIDK ENEMLVTVAHFHKEVFGTFGIPFLLRIHQGEHFREVMK RIQSLLDIQEKEFEKFKFAIVMMGRHQYINEDEYEVNLKD FEPQPGNMSHPRPWLGLDHFNKAPKRSRYTYLEKAIKI HN
Sequence Similarities: Belongs to the peptidase C19 family.Contains 1 MATH domain.
Gene Name: USP7 ubiquitin specific peptidase 7 (herpes virus-associated) [ Homo sapiens ]
Official Symbol: USP7
Synonyms: USP7; ubiquitin specific peptidase 7 (herpes virus-associated); HAUSP, ubiquitin specific protease 7 (herpes virus associated); ubiquitin carboxyl-terminal hydrolase 7;
Gene ID: 7874
mRNA Refseq: NM_003470
Protein Refseq: NP_003461
MIM: 602519
Uniprot ID: Q93009
Chromosome Location: 16p13.3
Pathway: FoxO family signaling, organism-specific biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; p53 pathway, organism-specific biosystem;
Function: cysteine-type endopeptidase activity; p53 binding; peptidase activity; protein C-terminus binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.