GMP Recombinant Porcine EGF Protein, His-Tagged
Cat.No. : | EGF-01P |
Product Overview : | GMP Recombinant Porcine EGF Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Porcine |
Source : | E.coli |
Tag : | His |
Description : | Epidermal growth factor (EGF) stimulates cell growth and differentiation by binding to its receptor, EGFR. Human EGF is a 6-kDa protein with 53 amino acid residues and three intramolecular disulfide bonds. EGF is present in various body fluids, including blood, milk, urine, saliva, seminal fluid, pancreatic juice, cerebrospinal fluid, and amniotic fluid. Biological activities ascribed to EGF include epithelial development, angiogenesis, inhibition of gastric acid secretion, fibroblast proliferation, and colony formation of epidermal cells in culture. |
Form : | Lyophilized |
AA Sequence : | MNSYSECPPSHDGYCLHGGVCMYIEAVDSYACNCVFGYVGERCQHRDLKWWELR with polyhistidine tag at the C-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Purity : | >95% as determined by SDS-PAGE. Ni-NTA chromatography |
Notes : | Please use within one month after protein reconstitution. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 8.0. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Gene Name | EGF epidermal growth factor [ Sus scrofa (pig) ] |
Official Symbol | EGF |
Gene ID | 397083 |
mRNA Refseq | NM_214020.2 |
Protein Refseq | NP_999185.1 |
UniProt ID | Q00968 |
◆ Recombinant Proteins | ||
EGF-12320H | Recombinant Human EGF protein, GST-tagged | +Inquiry |
EGF-2036H | Recombinant Human EGF Protein (Ala609-Gly751), His tagged | +Inquiry |
EGF-866M | Recombinant Mouse Epidermal Growth Factor, His-tagged | +Inquiry |
Egf-7197M | Recombinant Mouse Egf Protein, His-tagged | +Inquiry |
EGF-2038H | Recombinant Human EGF Protein (Asn971-Arg1023), C-His tagged | +Inquiry |
◆ Native Proteins | ||
Egf -635R | Native Rat Egf protein | +Inquiry |
EGF-26462TH | Native Human EGF | +Inquiry |
Egf-634M | Active Native Mouse Egf | +Inquiry |
Egf -634M | Active Native Mouse Egf protein | +Inquiry |
EGF-23H | Active Native Human EGF protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
EGF-2716HCL | Recombinant Human EGF cell lysate | +Inquiry |
EGF-973MCL | Recombinant Mouse EGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EGF Products
Required fields are marked with *
My Review for All EGF Products
Required fields are marked with *
0
Inquiry Basket