Recombinant Active Human GDF7 Protein, His-tagged(C-ter)
Cat.No. : | GDF7-107H |
Product Overview : | Recombinant Active Human GDF7 Protein with His tag (C-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes a member of the bone morphogenetic protein (BMP) family. BMPs belong to the transforming growth factor-beta superfamily of secreted signalling molecules that regulate diverse processes in growth, repair and embryonic development. In mouse, this gene functions as an inductive signal from the roof plate required for the specification of neuronal identity in the dorsal spinal cord. [provided by RefSeq, Jul 2008] |
Form : | Powder |
Bio-activity : | Determined by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is < 112 ng/mL. |
AA Sequence : | MTALAGTRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKELGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR |
Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 98% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | 20 mM Sodium citrate (pH 3.5) and 0.2 M NaCl. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | GDF7 growth differentiation factor 7 [ Homo sapiens ] |
Official Symbol | GDF7 |
Synonyms | GDF7; growth differentiation factor 7; growth/differentiation factor 7; BMP12; GDF-7; |
Gene ID | 151449 |
mRNA Refseq | NM_182828 |
Protein Refseq | NP_878248 |
MIM | 604651 |
UniProt ID | Q7Z4P5 |
◆ Recombinant Proteins | ||
GDF7-39H | Recombinant Human Growth Differentiation Factor 7 | +Inquiry |
GDF7-051H | Active Recombinant Human GDF7 Protein | +Inquiry |
GDF7-4828H | Recombinant Human GDF7 Protein, GST-tagged | +Inquiry |
Gdf7-279M | Recombinant Mouse Gdf7 Protein, His-tagged | +Inquiry |
Gdf7-1573R | Recombinant Rat Gdf7 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GDF7 Products
Required fields are marked with *
My Review for All GDF7 Products
Required fields are marked with *
0
Inquiry Basket