Recombinant Human GDF7 Protein, GST-tagged

Cat.No. : GDF7-4828H
Product Overview : Human GDF7 partial ORF ( NP_878248, 361 a.a. - 450 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the bone morphogenetic protein (BMP) family. BMPs belong to the transforming growth factor-beta superfamily of secreted signalling molecules that regulate diverse processes in growth, repair and embryonic development. In mouse, this gene functions as an inductive signal from the roof plate required for the specification of neuronal identity in the dorsal spinal cord. [provided by RefSeq
Molecular Mass : 35.64 kDa
AA Sequence : LGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GDF7 growth differentiation factor 7 [ Homo sapiens ]
Official Symbol GDF7
Synonyms GDF7; growth differentiation factor 7; growth/differentiation factor 7; BMP12; GDF-7;
Gene ID 151449
mRNA Refseq NM_182828
Protein Refseq NP_878248
MIM 604651
UniProt ID Q7Z4P5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GDF7 Products

Required fields are marked with *

My Review for All GDF7 Products

Required fields are marked with *

0
cart-icon
0
compare icon