Cat.No. :	GDF7-4828H
Product Overview :	Human GDF7 partial ORF ( NP_878248, 361 a.a. - 450 a.a.) recombinant protein with GST-tag at N-terminal.
Description :	This gene encodes a member of the bone morphogenetic protein (BMP) family. BMPs belong to the transforming growth factor-beta superfamily of secreted signalling molecules that regulate diverse processes in growth, repair and embryonic development. In mouse, this gene functions as an inductive signal from the roof plate required for the specification of neuronal identity in the dorsal spinal cord. [provided by RefSeq
Source :	Wheat Germ
Species :	Human
Tag :	GST
Molecular Mass :	35.64 kDa
AA Sequence :	LGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing :	12.5% SDS-PAGE Stained with Coomassie Blue.

Gene Name :	GDF7 growth differentiation factor 7 [ Homo sapiens ]
Official Symbol :	GDF7
Synonyms :	GDF7; growth differentiation factor 7; growth/differentiation factor 7; BMP12; GDF-7;
Gene ID :	151449
mRNA Refseq :	NM_182828
Protein Refseq :	NP_878248
MIM :	604651
UniProt ID :	Q7Z4P5

Online Inquiry