Recombinant Human GDF7 Protein, GST-tagged
| Cat.No. : | GDF7-4828H |
| Product Overview : | Human GDF7 partial ORF ( NP_878248, 361 a.a. - 450 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the bone morphogenetic protein (BMP) family. BMPs belong to the transforming growth factor-beta superfamily of secreted signalling molecules that regulate diverse processes in growth, repair and embryonic development. In mouse, this gene functions as an inductive signal from the roof plate required for the specification of neuronal identity in the dorsal spinal cord. [provided by RefSeq |
| Molecular Mass : | 35.64 kDa |
| AA Sequence : | LGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GDF7 growth differentiation factor 7 [ Homo sapiens ] |
| Official Symbol | GDF7 |
| Synonyms | GDF7; growth differentiation factor 7; growth/differentiation factor 7; BMP12; GDF-7; |
| Gene ID | 151449 |
| mRNA Refseq | NM_182828 |
| Protein Refseq | NP_878248 |
| MIM | 604651 |
| UniProt ID | Q7Z4P5 |
| ◆ Recombinant Proteins | ||
| GDF7-107H | Recombinant Active Human GDF7 Protein, His-tagged(C-ter) | +Inquiry |
| Gdf7-279M | Recombinant Mouse Gdf7 Protein, His-tagged | +Inquiry |
| GDF7-051H | Active Recombinant Human GDF7 Protein | +Inquiry |
| Gdf7-675M | Recombinant Mouse Gdf7 protein | +Inquiry |
| GDF7-4828H | Recombinant Human GDF7 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GDF7 Products
Required fields are marked with *
My Review for All GDF7 Products
Required fields are marked with *
