Recombinant Active Human IL36G Protein, His-tagged(C-ter)

Cat.No. : IL36G-198H
Product Overview : Recombinant Active Human IL36G Protein with His tag (C-ter) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : The protein encoded by this gene is a member of the interleukin 1 cytokine family. The activity of this cytokine is mediated by interleukin 1 receptor-like 2 (IL1RL2/IL1R-rp2), and is specifically inhibited by interleukin 1 family, member 5 (IL1F5/IL-1 delta). Interferon-gamma, tumor necrosis factor-alpha and interleukin 1, beta (IL1B) are reported to stimulate the expression of this cytokine in keratinocytes. The expression of this cytokine in keratinocytes can also be induced by a contact hypersensitivity reaction or herpes simplex virus infection. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2013]
Form : Powder
Bio-activity : Determined by its ability to induce IL-8 secretion in A431 cells. The ED50 for this effect is < 5 ng/mL.
AA Sequence : MSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND
Endotoxin : Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
Purity : > 98% (by SDS-PAGE)
Applications : SDS-PAGE
Notes : For laboratory research only, not for drug, diagnostic or other use.
Storage : Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
Storage Buffer : PBS (pH 8.0)
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.
Gene Name IL36G interleukin 36, gamma [ Homo sapiens ]
Official Symbol IL36G
Synonyms IL36G; interleukin 36, gamma; IL1F9, interleukin 1 family, member 9; interleukin-36 gamma; IL 1F9; IL 1H1; IL 1RP2; IL1E; IL1H1; interleukin 1 related protein 2; interleukin 1 epsilon; interleukin 1 homolog 1; IL-1 epsilon; IL-1-epsilon; IL-1(EPSILON); interleukin-1 epsilon; IL-1 related protein 2; IL-1-related protein 2; interleukin-1 homolog 1; interleukin-1 family member 9; interleukin 1 family, member 9; interleukin 1-related protein 2; IL1F9; IL-1F9; IL-1H1; IL1RP2; IL-1RP2;
Gene ID 56300
mRNA Refseq NM_019618
Protein Refseq NP_062564
MIM 605542
UniProt ID Q9NZH8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL36G Products

Required fields are marked with *

My Review for All IL36G Products

Required fields are marked with *

0

Inquiry Basket

cartIcon