Recombinant Active Human TGFA Protein, His-tagged(C-ter)

Cat.No. : TGFA-297H
Product Overview : Recombinant Active Human TGFA Protein with His tag (C-ter) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : This gene encodes a growth factor that is a ligand for the epidermal growth factor receptor, which activates a signaling pathway for cell proliferation, differentiation and development. This protein may act as either a transmembrane-bound ligand or a soluble ligand. This gene has been associated with many types of cancers, and it may also be involved in some cases of cleft lip/palate. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011]
Form : Powder
Bio-activity : Determined by its ability to induce 3T3 cells proliferation. The ED50 for this effect is < 0.2 ng/mL. The specific activity of recombinant human TGF alpha is > 5 x 10^6 IU/mg.
AA Sequence : MVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA
Endotoxin : Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
Purity : > 98% (by SDS-PAGE)
Applications : SDS-PAGE
Notes : For laboratory research only, not for drug, diagnostic or other use.
Storage : Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
Storage Buffer : PBS (pH 8.0)
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.
Gene Name TGFA transforming growth factor, alpha [ Homo sapiens ]
Official Symbol TGFA
Synonyms TGFA; transforming growth factor, alpha; protransforming growth factor alpha; TGF-alpha; TFGA;
Gene ID 7039
mRNA Refseq NM_001099691
Protein Refseq NP_001093161
MIM 190170
UniProt ID P01135

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TGFA Products

Required fields are marked with *

My Review for All TGFA Products

Required fields are marked with *

0
cart-icon
0
compare icon