Recombinant Active Mouse IL22 Protein, His-tagged(C-ter)

Cat.No. : Il22-178M
Product Overview : Recombinant Active Mouse IL22 Protein with His tag (C-ter) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Description : Predicted to enable cytokine activity. Acts upstream of or within several processes, including negative regulation of inflammatory response; reactive oxygen species metabolic process; and regulation of tyrosine phosphorylation of STAT protein. Predicted to be located in extracellular space. Is expressed in retina and skin. Used to study liposarcoma. Human ortholog(s) of this gene implicated in asthma. Orthologous to human IL22 (interleukin 22).
Form : Powder
Bio-activity : Determined by its ability to induce IL-10 secretion in COLO205 cells. The ED50 for this effect is < 0.3 ng/mL.
AA Sequence : MLPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV
Endotoxin : Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
Purity : > 98% (by SDS-PAGE)
Applications : SDS-PAGE
Notes : For laboratory research only, not for drug, diagnostic or other use.
Storage : Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
Storage Buffer : PBS (pH 7.4)
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.
Gene Name Il22 interleukin 22 [ Mus musculus ]
Official Symbol Il22
Synonyms IL22; interleukin 22; interleukin-22; ILTIF alpha; IL-TIF alpha; interleukin-22a; IL-10-related T-cell-derived-inducible factor; interleukin 10-related T cell-derived inducible factor; IL-22; Iltif; IL-22a; ILTIFa; MGC129416; MGC129417;
Gene ID 50929
mRNA Refseq NM_016971
Protein Refseq NP_058667

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL22 Products

Required fields are marked with *

My Review for All IL22 Products

Required fields are marked with *

0
cart-icon
0
compare icon