Recombinant Alternaria Alternata ALTA1 Protein (19-157 aa), His-tagged
Cat.No. : | ALTA1-1562A |
Product Overview : | Recombinant Alternaria Alternata (Alternaria rot fungus) (Torula alternata) ALTA1 Protein (19-157 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Alternaria Alternata |
Source : | Yeast |
Tag : | His |
Protein Length : | 19-157 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 17.2 kDa |
AA Sequence : | APLESRQDTASCPVTTEGDYVWKISEFYGRKPEGTYYNSLGFNIKATNGGTLDFTCSAQADKLEDHKWYSCGENSFMDFSFDSDRSGLLLKQKVSDDITYVATATLPNYCRAGGNGPKDFVCQGVADAYITLVTLPKSS |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Synonyms | ALTA1; Allergen: Alt a 1; |
UniProt ID | P79085 |
◆ Recombinant Proteins | ||
ALTA1-3714A | Recombinant Alternaria alternata ALTA1 protein, His-tagged | +Inquiry |
ALTA1-08A | Recombinant Alternaria arborescens ALTA1 Protein, His-tagged | +Inquiry |
ALTA1-562A | Recombinant Alternaria alternata ALTA1 protein | +Inquiry |
ALTA1-1562A | Recombinant Alternaria Alternata ALTA1 Protein (19-157 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ALTA1 Products
Required fields are marked with *
My Review for All ALTA1 Products
Required fields are marked with *
0
Inquiry Basket