Recombinant Alternaria alternata ALTA1 protein, His-tagged
Cat.No. : | ALTA1-3714A |
Product Overview : | Recombinant Alternaria alternata ALTA1 protein(P79085)(19-157aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Alternaria alternata |
Source : | E.coli |
Tag : | His |
Protein Length : | 19-157aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 19.2 kDa |
AA Sequence : | APLESRQDTASCPVTTEGDYVWKISEFYGRKPEGTYYNSLGFNIKATNGGTLDFTCSAQADKLEDHKWYSCGENSFMDFSFDSDRSGLLLKQKVSDDITYVATATLPNYCRAGGNGPKDFVCQGVADAYITLVTLPKSS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
ALTA1-3714A | Recombinant Alternaria alternata ALTA1 protein, His-tagged | +Inquiry |
ALTA1-562A | Recombinant Alternaria alternata ALTA1 protein | +Inquiry |
ALTA1-1562A | Recombinant Alternaria Alternata ALTA1 Protein (19-157 aa), His-tagged | +Inquiry |
ALTA1-08A | Recombinant Alternaria arborescens ALTA1 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALTA1 Products
Required fields are marked with *
My Review for All ALTA1 Products
Required fields are marked with *
0
Inquiry Basket