Recombinant Alternaria arborescens ALTA1 Protein, His-tagged

Cat.No. : ALTA1-08A
Product Overview : Recombinant Alternaria arborescens ALTA1 Protein, fused to His-tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Alternaria arborescens
Source : E.coli
Tag : His
Description : Major allergen Alt a 1
Form : PBS (pH 7.4)
Molecular Mass : 16.7 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMDTASCPVTTEGDYVWKISEFYGRKPEGTYYNSLGFNIKATNGGTLDFTCSAQADKLEDHKWYSCGENSFMDFSFDSDRSGLLLKQKVSDDITYVATATLPNYCRAGGNGPKDFVCQGVADAYITLVTLPKSS
Purity : > 90%
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 1mg/ml
Gene Name AA0111_g6065 Major allergen Alt a 1 [ Alternaria arborescens ]
Official Symbol ALTA1
Gene ID 39621843
mRNA Refseq XM_028652247
Protein Refseq XP_028506422
UniProt ID P79085

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ALTA1 Products

Required fields are marked with *

My Review for All ALTA1 Products

Required fields are marked with *

0
cart-icon