| Species : |
Bovine |
| Source : |
Yeast |
| Tag : |
His |
| Protein Length : |
24-153 aa |
| Form : |
For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
| Molecular Mass : |
16.3 kDa |
| AASequence : |
GVIIPQSPGCPPTEDKNFPQHVRVNLNIVNRSTNSRRPTDYHKRSTSPWTLHRNEDPERYPSVIWEAKCSHSGCINAEGKVDHHMNSVTIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIVRHLA |
| Purity : |
Greater than 90% as determined by SDS-PAGE. |
| Storage : |
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : |
Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |