Recombinant Bovine IL17A protein, His-tagged
Cat.No. : | IL17A-4688B |
Product Overview : | Recombinant Bovine IL17A protein(Q687Y7)(24-153 aa), fused with N-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | Yeast |
Tag : | His |
Protein Length : | 24-153 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 16.3 kDa |
AASequence : | GVIIPQSPGCPPTEDKNFPQHVRVNLNIVNRSTNSRRPTDYHKRSTSPWTLHRNEDPERYPSVIWEAKCSHSGCINAEGKVDHHMNSVTIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIVRHLA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
◆ Recombinant Proteins | ||
IL17A-674P | Recombinant Pig IL17A protein, His-tagged | +Inquiry |
Il17a-093M | Active Recombinant Mouse Il17a Protein | +Inquiry |
Il17a-094M | Active Recombinant Mouse Il17a Protein | +Inquiry |
IL17A-168C | Active Recombinant Canine IL17A protein(Gly26-Ala155) | +Inquiry |
IL17A-288H | Recombinant Human IL17A, StrepII-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL17A-001HCL | Recombinant Human IL17A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL17A Products
Required fields are marked with *
My Review for All IL17A Products
Required fields are marked with *