Recombinant Mouse Saa1 protein, His-SUMO-tagged
Cat.No. : | Saa1-3468M |
Product Overview : | Recombinant Mouse Saa1 protein(P05366)(20-122aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 20-122aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 27.8 kDa |
AA Sequence : | GFFSFVHEAFQGAGDMWRAYTDMKEANWKNSDKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEANRHGRSGKDPNYYRPPGLPDKY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Saa1 serum amyloid A 1 [ Mus musculus ] |
Official Symbol | Saa1 |
Synonyms | SAA1; serum amyloid A 1; serum amyloid A-1 protein; serum amyloid A 2; Saa2; Saa-1; |
Gene ID | 20208 |
mRNA Refseq | NM_009117 |
Protein Refseq | NP_033143 |
◆ Recombinant Proteins | ||
SAA1-6232H | Recombinant Full Length Human SAA1 Protein (Met1-Tyr122), C-His tagged | +Inquiry |
SAA1-3692H | Recombinant Human SAA1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SAA1-14633M | Recombinant Mouse SAA1 Protein | +Inquiry |
SAA1-1355S | Recombinant Sheep SAA1 protein, His-tagged | +Inquiry |
SAA1-795H | Recombinant Horse SAA1 Protein (1-110 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SAA1-2081HCL | Recombinant Human SAA1 293 Cell Lysate | +Inquiry |
SAA1-2080HCL | Recombinant Human SAA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Saa1 Products
Required fields are marked with *
My Review for All Saa1 Products
Required fields are marked with *
0
Inquiry Basket