Recombinant Canine IL-5

• Cat.No.: IL5-27C
• Product Overview: Canine IL-5 was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified.

Specification

• Species: Canine
• Source: Yeast
• Tag: Non
• Description: IL-3, IL-5, and GM-CSF are important in regulating eosinophil development. Of these three cytokines, IL-5 is the most specific to the eosinophil lineage and is responsible for selective terminal differentiation of eosinophils. The IL-5 receptor is composed of an alpha and a beta-common chain. The alpha subunit is specific for the IL-5 molecule, whereas the beta-common subunit also recognized by IL-3 and GM-CSF. IL-5 is produced by both hematopoietic and non-hematopoietic cells including T cells, granulocytes, and natural helper cells. It is associated with the cause of several allergic diseases including allergic rhinitis and asthma.
• Form: Lyophilized
• Molecular Mass: 13.1 kDa
• AA Sequence: VENPMNRLVAETLTLLSTHRTWLIGDGNLMIPTPENKNHQLCIKEVFQGIDTLKNQTAHGEAVDKLFQNLSLIKE HIERQKKRCAGERWRVTKFLDYLQVFLGVINTEWTPES
• Applications: The Canine IL-5 protein can be used in cell culture, as an IL-5 ELISA Standard, and as a Western Blot Control.
• Storage: -20 C