Recombinant Canine IL-5

Cat.No. : IL5-27C
Product Overview : Canine IL-5 was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Canine
Source : Yeast
Tag : Non
Description : IL-3, IL-5, and GM-CSF are important in regulating eosinophil development. Of these three cytokines, IL-5 is the most specific to the eosinophil lineage and is responsible for selective terminal differentiation of eosinophils. The IL-5 receptor is composed of an alpha and a beta-common chain. The alpha subunit is specific for the IL-5 molecule, whereas the beta-common subunit also recognized by IL-3 and GM-CSF. IL-5 is produced by both hematopoietic and non-hematopoietic cells including T cells, granulocytes, and natural helper cells. It is associated with the cause of several allergic diseases including allergic rhinitis and asthma.
Form : Lyophilized
Molecular Mass : 13.1 kDa
AA Sequence : VENPMNRLVAETLTLLSTHRTWLIGDGNLMIPTPENKNHQLCIKEVFQGIDTLKNQTAHGEAVDKLFQNLSLIKE HIERQKKRCAGERWRVTKFLDYLQVFLGVINTEWTPES
Applications : The Canine IL-5 protein can be used in cell culture, as an IL-5 ELISA Standard, and as a Western Blot Control.
Storage : -20 C

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL5 Products

Required fields are marked with *

My Review for All IL5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon