Recombinant Canine IL-5
Cat.No. : | IL5-27C |
Product Overview : | Canine IL-5 was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Canine |
Source : | Yeast |
Tag : | Non |
Description : | IL-3, IL-5, and GM-CSF are important in regulating eosinophil development. Of these three cytokines, IL-5 is the most specific to the eosinophil lineage and is responsible for selective terminal differentiation of eosinophils. The IL-5 receptor is composed of an alpha and a beta-common chain. The alpha subunit is specific for the IL-5 molecule, whereas the beta-common subunit also recognized by IL-3 and GM-CSF. IL-5 is produced by both hematopoietic and non-hematopoietic cells including T cells, granulocytes, and natural helper cells. It is associated with the cause of several allergic diseases including allergic rhinitis and asthma. |
Form : | Lyophilized |
Molecular Mass : | 13.1 kDa |
AA Sequence : | VENPMNRLVAETLTLLSTHRTWLIGDGNLMIPTPENKNHQLCIKEVFQGIDTLKNQTAHGEAVDKLFQNLSLIKE HIERQKKRCAGERWRVTKFLDYLQVFLGVINTEWTPES |
Applications : | The Canine IL-5 protein can be used in cell culture, as an IL-5 ELISA Standard, and as a Western Blot Control. |
Storage : | -20 C |
◆ Recombinant Proteins | ||
IL5-0295H | Active Recombinant Human IL5 protein | +Inquiry |
IL5-651H | Recombinant Human IL5 protein, His & T7-tagged | +Inquiry |
IL5-5734H | Recombinant Human IL5 protein, hFc-Flag-tagged | +Inquiry |
IL5-354I | Active Recombinant Human IL5 Protein (116 aa) | +Inquiry |
IL5-1044C | Recombinant Chicken IL5 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL5-496MCL | Recombinant Mouse IL5 cell lysate | +Inquiry |
IL5-456CCL | Recombinant Canine IL5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL5 Products
Required fields are marked with *
My Review for All IL5 Products
Required fields are marked with *