Recombinant Chicken KITLG Protein

Cat.No. : KITLG-39C
Product Overview : The Chicken SCF recombinant protein without tag was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Chicken
Source : Yeast
Molecular Mass : 22.5 kDa
AA Sequence : QSSCGNPVTDDVNDIAKLVGNLPNDYLITLKYVPKMDSLPNHCWLHLMVPEFSRSLHNLLQKFSDISDMSDVLSNYSIINNLTRIINDLMACLAFDKNKDFIKENGHLYEEDRFIPENFFRLFNSTIEVYKEFADSLDKNDCIMPSTVETPENDSRVAVTKTISFPPVAASSLRNDSIGSNTSSNSNKEALGFISSSSLQ
Applications : The Chicken SCF endotoxin-free recombinant protein can be used in cell culture, as an SCF ELISA Standard, and as a Western Blot Control.
Gene Name KITLG KIT ligand [ Gallus gallus (chicken) ]
Official Symbol KITLG
Synonyms KITLG; KIT ligand; kit ligand; C-kit ligand; KIT ligand precursor form 1; KIT ligand precursor form 4; MGF; SCF; mast cell growth factor; stem cell factor; EC 3.2.1.31
Gene ID 396028
mRNA Refseq NM_205130
Protein Refseq NP_990461
UniProt ID https://www.uniprot.org/uniprot/Q09108

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KITLG Products

Required fields are marked with *

My Review for All KITLG Products

Required fields are marked with *

0
cart-icon