Recombinant Chicken KITLG Protein

• Cat.No.: KITLG-39C
• Product Overview: The Chicken SCF recombinant protein without tag was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified.

Specification

• Species: Chicken
• Source: Yeast
• Molecular Mass: 22.5 kDa
• AA Sequence: QSSCGNPVTDDVNDIAKLVGNLPNDYLITLKYVPKMDSLPNHCWLHLMVPEFSRSLHNLLQKFSDISDMSDVLSNYSIINNLTRIINDLMACLAFDKNKDFIKENGHLYEEDRFIPENFFRLFNSTIEVYKEFADSLDKNDCIMPSTVETPENDSRVAVTKTISFPPVAASSLRNDSIGSNTSSNSNKEALGFISSSSLQ
• Applications: The Chicken SCF endotoxin-free recombinant protein can be used in cell culture, as an SCF ELISA Standard, and as a Western Blot Control.

Gene Information

• Gene Name: KITLG KIT ligand [ Gallus gallus (chicken) ]
• Official Symbol: KITLG
• Synonyms: KITLG; KIT ligand; kit ligand; C-kit ligand; KIT ligand precursor form 1; KIT ligand precursor form 4; MGF; SCF; mast cell growth factor; stem cell factor; EC 3.2.1.31
• Gene ID: 396028
• mRNA Refseq: NM_205130
• Protein Refseq: NP_990461
• UniProt ID: https://www.uniprot.org/uniprot/Q09108