Recombinant Dog CCL17 protein, His-tagged
| Cat.No. : | CCL17-3632D |
| Product Overview : | Recombinant Dog CCL17 protein(Q95N01)(24-99aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Dog |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 24-99aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 10.1 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | ARGTNVGRECCLEYFKGAIPISRLTRWYKTSGECPKDAIVFVTVQGKSICSDPKDKRVKKAVRYLQRTWKGGPQES |
| Gene Name | CCL17 chemokine (C-C motif) ligand 17 [ Canis lupus familiaris ] |
| Official Symbol | CCL17 |
| Synonyms | CCL17; chemokine (C-C motif) ligand 17; C-C motif chemokine 17; CC chemokine TARC; small-inducible cytokine A17; thymus and activation-regulated chemokine; TARC; |
| Gene ID | 403586 |
| mRNA Refseq | NM_001003051 |
| Protein Refseq | NP_001003051 |
| ◆ Recombinant Proteins | ||
| Ccl17-622M | Recombinant Mouse Ccl17 protein | +Inquiry |
| Ccl17-625M | Recombinant Mouse Chemokine(C-C motif) Ligand 17 | +Inquiry |
| CCL17-3632D | Recombinant Dog CCL17 protein, His-tagged | +Inquiry |
| CCL17-1471H | Recombinant Human CCL17 Protein (Ala24-Ser94), N-GST tagged | +Inquiry |
| CCL17-30149TH | Recombinant Human CCL17, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCL17-535MCL | Recombinant Mouse CCL17 cell lysate | +Inquiry |
| CCL17-001CCL | Recombinant Cynomolgus CCL17 cell lysate | +Inquiry |
| CCL17-588HCL | Recombinant Human CCL17 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL17 Products
Required fields are marked with *
My Review for All CCL17 Products
Required fields are marked with *
