Recombinant Dog IL13 protein, His-tagged

• Cat.No.: IL13-4673D
• Product Overview: Recombinant Dog IL13 protein(Q9N0W9)(19-131 aa), fused with N-terminal His tag, was expressed in Yeast.

Specification

• Species: Dog
• Source: Yeast
• Tag: His
• Protein Length: 19-131 aa
• Form: For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
• Molecular Mass: 14.5 kDa
• AASequence: SPSPVTPSPTLKELIEELVNITQNQASLCNGSMVWSVNLTAGMYCAALESLINVSDCSAIQRTQRMLKALCSQKPAAGQISSERSRDTKIEVIQLVKNLLTYVRGVYRHGNFR
• Purity: Greater than 95% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.

Gene Information

• Gene Name: IL13 interleukin 13 [ Canis lupus familiaris ]
• Official Symbol: IL13
• Synonyms: IL13; interleukin 13; interleukin-13; IL-13
• Gene ID: 442990
• mRNA Refseq: NM_001003384
• Protein Refseq: NP_001003384