Recombinant Dog IL13 protein, His-tagged
Cat.No. : | IL13-4673D |
Product Overview : | Recombinant Dog IL13 protein(Q9N0W9)(19-131 aa), fused with N-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | Yeast |
Tag : | His |
Protein Length : | 19-131 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 14.5 kDa |
AASequence : | SPSPVTPSPTLKELIEELVNITQNQASLCNGSMVWSVNLTAGMYCAALESLINVSDCSAIQRTQRMLKALCSQKPAAGQISSERSRDTKIEVIQLVKNLLTYVRGVYRHGNFR |
Purity : | Greater than 95% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | IL13 interleukin 13 [ Canis lupus familiaris ] |
Official Symbol | IL13 |
Synonyms | IL13; interleukin 13; interleukin-13; IL-13; |
Gene ID | 442990 |
mRNA Refseq | NM_001003384 |
Protein Refseq | NP_001003384 |
◆ Recombinant Proteins | ||
IL13-234B | Active Recombinant Bovine Interleukin 13 | +Inquiry |
IL13-1568C | Active Recombinant Cynomolgus IL13 protein, His-tagged | +Inquiry |
Il13-256I | Active Recombinant Mouse Il13 Protein, His-tagged | +Inquiry |
IL13-7542D | Recombinant Dog IL13 protein(19-131aa), His-tagged | +Inquiry |
IL13-542R | Recombinant Rhesus IL13 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL13-1336MCL | Recombinant Mouse IL13 cell lysate | +Inquiry |
IL13-2922HCL | Recombinant Human IL13 cell lysate | +Inquiry |
IL13-1894CCL | Recombinant Cynomolgus IL13 cell lysate | +Inquiry |
IL13-001HCL | Recombinant Human IL13 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL13 Products
Required fields are marked with *
My Review for All IL13 Products
Required fields are marked with *