Recombinant Dog SPP1 protein, His-tagged
| Cat.No. : | SPP1-7901D |
| Product Overview : | Recombinant Dog SPP1 protein(Ile7~Ser232), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | December 25, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Ile7~Ser232 |
| Tag : | N-His |
| Form : | Lyophilized from sterile PBS, pH7.4, 5% Trehalose, 5% Manitol |
| Molecular Mass : | The protein has a calculated MW of 26 kDa. |
| Endotoxin : | <0.01EU/ug by LAL. |
| Purity : | >90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.07mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | MHHHHHHHHHHIAYAIPIKHADSGSSEEKQNAVLTEETDDFKQKTFSSKSNESHDDVDEDDGDDVDSQDSVDSNDLDDDSNESDESDELVTDFPTDIPATQLFTPAVPTRGSYDGRGDSVAYGLRSKSKKSHKYEVQYPDSTEEDFTSLVKSASMEDDFNAVLLSRTVRGTSDRDSHAKDSQETSQLDDHSMETKDRKHSQEYKLRASDESNMHSHEIGSQENSEVSSELVSQLSQS |
| Gene Name | SPP1 secreted phosphoprotein 1 [ Canis lupus familiaris ] |
| Official Symbol | SPP1 |
| Synonyms | SPP1; secreted phosphoprotein 1; osteopontin; secreted phosphoprotein 1 (osteopontin, bone sialoprotein I, early T-lymphocyte activation 1); |
| Gene ID | 478471 |
| ◆ Recombinant Proteins | ||
| Abi2-3041M | Recombinant Mouse Abi2, His-tagged | +Inquiry |
| ABI2-9247H | Recombinant Human ABI2 protein, GST-tagged | +Inquiry |
| ABI2-3532H | Recombinant Human ABI2 protein, His-tagged | +Inquiry |
| ABI2-220M | Recombinant Mouse ABI2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ABI2-4266H | Recombinant Human ABI2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ABI2-9127HCL | Recombinant Human ABI2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABI2 Products
Required fields are marked with *
My Review for All ABI2 Products
Required fields are marked with *
