Recombinant Full Length Human B2M Protein, GST-tagged
Cat.No. : | B2M-1705HF |
Product Overview : | Human B2M full-length ORF ( AAH32589, 1 a.a. - 119 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 119 amino acids |
Description : | This gene encodes a serum protein found in association with the major histocompatibility complex (MHC) class I heavy chain on the surface of nearly all nucleated cells. The protein has a predominantly beta-pleated sheet structure that can form amyloid fibrils in some pathological conditions. A mutation in this gene has been shown to result in hypercatabolic hypoproteinemia. |
Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 38.83 kDa |
AA Sequence : | MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | B2M beta-2-microglobulin [ Homo sapiens ] |
Official Symbol | B2M |
Synonyms | B2M; beta-2-microglobulin; beta-2-microglobin; beta chain of MHC class I molecules |
Gene ID | 567 |
mRNA Refseq | NM_004048 |
Protein Refseq | NP_004039 |
MIM | 109700 |
UniProt ID | P61769 |
◆ Recombinant Proteins | ||
B2M-002H | Recombinant Human B2M protein, GST-tagged | +Inquiry |
B2M-0234H | Recombinant Human B2M Protein (Met1-Met119), C-His-tagged | +Inquiry |
B2M-286R | Recombinant Rhesus monkey B2M Protein, His-tagged | +Inquiry |
B2M-6744H | Recombinant Human B2M protein, hFc-tagged | +Inquiry |
B2M-6236H | Recombinant Human B2M Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
B2M-8046H | Native Human Beta 2 MicroGlobulin | +Inquiry |
B2M-13H | Native Human B2M | +Inquiry |
B2M-5366H | Native Human Beta-2-Microglobulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
B2M-1512CCL | Recombinant Cynomolgus B2M cell lysate | +Inquiry |
B2M-1550RCL | Recombinant Rat B2M cell lysate | +Inquiry |
B2M-1656MCL | Recombinant Mouse B2M cell lysate | +Inquiry |
B2M-2204HCL | Recombinant Human B2M cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All B2M Products
Required fields are marked with *
My Review for All B2M Products
Required fields are marked with *
0
Inquiry Basket