Recombinant Full Length Human Bcl-2 Homologous Antagonist/Killer(Bak1) Protein, His-Tagged
Cat.No. : | RFL36987HF |
Product Overview : | Recombinant Full Length Human Bcl-2 homologous antagonist/killer(BAK1) Protein (Q16611) (1-211aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-211) |
Form : | Lyophilized powder |
AA Sequence : | MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEM VTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFE SGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAA LNLGNGPILNVLVVLGVVLLGQFVVRRFFKS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BAK1 |
Synonyms | BAK1; BAK; BCL2L7; CDN1; Bcl-2 homologous antagonist/killer; Apoptosis regulator BAK; Bcl-2-like protein 7; Bcl2-L-7 |
UniProt ID | Q16611 |
◆ Recombinant Proteins | ||
BAK1-509R | Recombinant Rhesus monkey BAK1 Protein, His-tagged | +Inquiry |
BAK1-35H | Recombinant Human BAK1 Protein, His-tagged | +Inquiry |
BAK1-26166TH | Recombinant Human BAK1 Protein, GST-tagged | +Inquiry |
BAK1-2609C | Recombinant Chicken BAK1 | +Inquiry |
BAK1-26168TH | Recombinant Human BAK1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
BAK1-8519HCL | Recombinant Human BAK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BAK1 Products
Required fields are marked with *
My Review for All BAK1 Products
Required fields are marked with *
0
Inquiry Basket