Recombinant Full Length Human C4orf33 Protein, GST-tagged

Cat.No. : C4orf33-2645HF
Product Overview : Human C4orf33 full-length ORF (NP_775758.1, 1 a.a. - 199 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 199 amino acids
Description : C4orf33 (Chromosome 4 Open Reading Frame 33) is a Protein Coding gene.
Molecular Mass : 49.8 kDa
AA Sequence : MDFKIEHTWDGFPVKHEPVFIRLNPGDRGVMMDISAPFFRDPPAPLGEPGKPFNELWDYEVVEAFFLNDITEQYLEVELCPHGQHLVLLLSGRRNVWKQELPLSFRVSRGETKWEGKAYLPWSYFPPNVTKFNSFAIHGSKDKRSYEALYPVPQHELQQGQKPDFHCLEYFKSFNFNTLLGEEWKQPESDLWLIEKCDI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C4orf33 chromosome 4 open reading frame 33 [ Homo sapiens ]
Official Symbol C4orf33
Synonyms C4ORF33; chromosome 4 open reading frame 33; UPF0462 protein C4orf33; FLJ33703;
Gene ID 132321
mRNA Refseq NM_001099783
Protein Refseq NP_001093253
UniProt ID Q8N1A6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C4orf33 Products

Required fields are marked with *

My Review for All C4orf33 Products

Required fields are marked with *

0
cart-icon
0
compare icon