Recombinant Full Length Human C4orf33 Protein, GST-tagged

• Cat.No.: C4orf33-2645HF
• Product Overview: Human C4orf33 full-length ORF (NP_775758.1, 1 a.a. - 199 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 199 amino acids
• Description: C4orf33 (Chromosome 4 Open Reading Frame 33) is a Protein Coding gene.
• Molecular Mass: 49.8 kDa
• AA Sequence: MDFKIEHTWDGFPVKHEPVFIRLNPGDRGVMMDISAPFFRDPPAPLGEPGKPFNELWDYEVVEAFFLNDITEQYLEVELCPHGQHLVLLLSGRRNVWKQELPLSFRVSRGETKWEGKAYLPWSYFPPNVTKFNSFAIHGSKDKRSYEALYPVPQHELQQGQKPDFHCLEYFKSFNFNTLLGEEWKQPESDLWLIEKCDI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C4orf33 chromosome 4 open reading frame 33 [ Homo sapiens ]
• Official Symbol: C4orf33
• Synonyms: C4ORF33; chromosome 4 open reading frame 33; UPF0462 protein C4orf33; FLJ33703
• Gene ID: 132321
• mRNA Refseq: NM_001099783
• Protein Refseq: NP_001093253
• UniProt ID: Q8N1A6