Recombinant Human C4orf33 Protein, GST-Tagged
Cat.No. : | C4orf33-0065H |
Product Overview : | Human C4orf33 full-length ORF (NP_775758.1, 1 a.a. - 199 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | C4orf33 (Chromosome 4 Open Reading Frame 33) is a Protein Coding gene. |
Molecular Mass : | 49.8 kDa |
AA Sequence : | MDFKIEHTWDGFPVKHEPVFIRLNPGDRGVMMDISAPFFRDPPAPLGEPGKPFNELWDYEVVEAFFLNDITEQYLEVELCPHGQHLVLLLSGRRNVWKQELPLSFRVSRGETKWEGKAYLPWSYFPPNVTKFNSFAIHGSKDKRSYEALYPVPQHELQQGQKPDFHCLEYFKSFNFNTLLGEEWKQPESDLWLIEKCDI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C4orf33 chromosome 4 open reading frame 33 [ Homo sapiens ] |
Official Symbol | C4orf33 |
Synonyms | C4ORF33; chromosome 4 open reading frame 33; UPF0462 protein C4orf33; FLJ33703; |
Gene ID | 132321 |
mRNA Refseq | NM_001099783 |
Protein Refseq | NP_001093253 |
UniProt ID | Q8N1A6 |
◆ Recombinant Proteins | ||
C4orf33-5476H | Recombinant Human C4orf33 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
C4orf33-554H | Recombinant Human C4orf33 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
C4orf33-0065H | Recombinant Human C4orf33 Protein, GST-Tagged | +Inquiry |
C4orf33-2645HF | Recombinant Full Length Human C4orf33 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C4orf33-8028HCL | Recombinant Human C4orf33 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C4orf33 Products
Required fields are marked with *
My Review for All C4orf33 Products
Required fields are marked with *
0
Inquiry Basket