Recombinant Human C4orf33 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | C4orf33-554H |
| Product Overview : | C4orf33 MS Standard C13 and N15-labeled recombinant protein (NP_001093253) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | C4orf33 (Chromosome 4 Open Reading Frame 33) is a Protein Coding gene. |
| Molecular Mass : | 23.3 kDa |
| AA Sequence : | MDFKIEHTWDGFPVKHEPVFIRLNPGDRGVMMDISAPFFRDPPAPLGEPGKPFNELWDYEVVEAFFLNDITEQYLEVELCPHGQHLVLLLSGRRNVWKQELPLSFRMSRGETKWEGKAYLPWSYFPPNVTKFNSFAIHGSKDKRSYEALYPVPQHELQQGQKPDFHCLEYFKSFNFNTLLGEEWKQPESDLWLIEKCDITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | C4orf33 chromosome 4 open reading frame 33 [ Homo sapiens (human) ] |
| Official Symbol | C4orf33 |
| Synonyms | C4ORF33; chromosome 4 open reading frame 33; UPF0462 protein C4orf33; FLJ33703; |
| Gene ID | 132321 |
| mRNA Refseq | NM_001099783 |
| Protein Refseq | NP_001093253 |
| UniProt ID | Q8N1A6 |
| ◆ Recombinant Proteins | ||
| C4orf33-2645HF | Recombinant Full Length Human C4orf33 Protein, GST-tagged | +Inquiry |
| C4orf33-0065H | Recombinant Human C4orf33 Protein, GST-Tagged | +Inquiry |
| C4orf33-5476H | Recombinant Human C4orf33 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| C4orf33-554H | Recombinant Human C4orf33 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| C4orf33-8028HCL | Recombinant Human C4orf33 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C4orf33 Products
Required fields are marked with *
My Review for All C4orf33 Products
Required fields are marked with *
