Recombinant Human C4orf33 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : C4orf33-5476H
Product Overview : C4orf33 MS Standard C13 and N15-labeled recombinant protein (NP_775758) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : C4orf33 (Chromosome 4 Open Reading Frame 33) is a Protein Coding gene.
Molecular Mass : 23.4 kDa
AA Sequence : MDFKIEHTWDGFPVKHEPVFIRLNPGDRGVMMDISAPFFRDPPAPLGEPGKPFNELWDYEVVEAFFLNDITEQYLEVELCPHGQHLVLLLSGRRNVWKQELPLSFRVSRGETKWEGKAYLPWSYFPPNVTKFNSFAIHGSKDKRSYEALYPVPQHELQQGQKPDFHCLEYFKSFNFNTLLGEEWKQPESDLWLIEKCDITRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name C4orf33 chromosome 4 open reading frame 33 [ Homo sapiens (human) ]
Official Symbol C4orf33
Synonyms C4ORF33; chromosome 4 open reading frame 33; UPF0462 protein C4orf33; FLJ33703;
Gene ID 132321
mRNA Refseq NM_173487
Protein Refseq NP_775758
UniProt ID Q8N1A6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C4orf33 Products

Required fields are marked with *

My Review for All C4orf33 Products

Required fields are marked with *

0
cart-icon