Recombinant Full Length Human CA5A Protein, GST-tagged
Cat.No. : | CA5A-2740HF |
Product Overview : | Human CA5A full-length ORF (NP_001730.1, 1 a.a. - 305 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 305 amino acids |
Description : | Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA VA is localized in the mitochondria and expressed primarily in the liver. It may play an important role in ureagenesis and gluconeogenesis. CA5A gene maps to chromosome 16q24.3 and an unprocessed pseudogene has been assigned to 16p12-p11.2. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 61.2 kDa |
AA Sequence : | MLGRNTWKTSAFSFLVEQMWAPLWSRSMRPGRWCSQRSCAWQTSNNTLHPLWTVPVSVPGGTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPLENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVIGVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLTESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATNEGTRS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CA5A carbonic anhydrase VA, mitochondrial [ Homo sapiens ] |
Official Symbol | CA5A |
Synonyms | CA5A; carbonic anhydrase VA, mitochondrial; CA5; carbonic anhydrase 5A, mitochondrial; CAV; CAVA; CA-VA; carbonic dehydratase; carbonate dehydratase VA; carbonic anhydrase V, mitochondrial; |
Gene ID | 763 |
mRNA Refseq | NM_001739 |
Protein Refseq | NP_001730 |
MIM | 114761 |
UniProt ID | P35218 |
◆ Recombinant Proteins | ||
CAR5A-2721M | Recombinant Mouse CAR5A Protein | +Inquiry |
CA5A-0242H | Recombinant Human CA5A Protein, GST-Tagged | +Inquiry |
CA5A-1142H | Recombinant Human CA5A, His tagged | +Inquiry |
Car5a-7850M | Recombinant Mouse Car5a protein, His-tagged | +Inquiry |
CA5A-5924H | Recombinant Human CA5A protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CA5A Products
Required fields are marked with *
My Review for All CA5A Products
Required fields are marked with *