Recombinant Full Length Human CD177 Protein, C-Flag-tagged
Cat.No. : | CD177-962HFL |
Product Overview : | Recombinant Full Length Human CD177 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a glycosyl-phosphatidylinositol (GPI)-linked cell surface glycoprotein that plays a role in neutrophil activation. The protein can bind platelet endothelial cell adhesion molecule-1 and function in neutrophil transmigration. Mutations in this gene are associated with myeloproliferative diseases. Over-expression of this gene has been found in patients with polycythemia rubra vera. Autoantibodies against the protein may result in pulmonary transfusion reactions, and it may be involved in Wegener's granulomatosis. A related pseudogene, which is adjacent to this gene on chromosome 19, has been identified. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 46.2 kDa |
AA Sequence : | MSPVLLLALLGFILPLPGVQALLCQFGTVQHVWKVSDLPRQWTPKNTSCDSGLGCQDTLMLIESGPQVSL VLSKGCTEAKDQEPRVTEHRMGPGLSLISYTFVCRQEDFCNNLVNSLPLWAPQPPADPGSLRCPVCLSME GCLEGTTEEICPKGTTHCYDGLLRLRGGGIFSNLRVQGCMPQPGCNLLNGTQEIGPVGMTENCNRKDFLT CHRGTTIMTHGNLAQEPTDWTTSNTEMCEVGQVCQETLLLLDVGLTSTLVGTKGCSTVGAQNSQKTTIHS APPGVLVASYTHFCSSDLCNSASSSSVLLNSLPPQAAPVPGDRQCPTCVQPLGTCSSGSPRMTCPRGTTH CYDGYIHLSGGGLSTKMSIQGCVAQPSSFLLNHTRQIGIFSAREKRDVQPPASQHEGGGAEGLESLTWGV GLALAPALWWGVVCPSCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | CD177 CD177 molecule [ Homo sapiens (human) ] |
Official Symbol | CD177 |
Synonyms | NB1; PRV1; HNA2A; PRV-1; HNA-2a; NB1 GP |
Gene ID | 57126 |
mRNA Refseq | NM_020406.4 |
Protein Refseq | NP_065139.2 |
MIM | 162860 |
UniProt ID | Q8N6Q3 |
◆ Recombinant Proteins | ||
CD177-2990HF | Recombinant Full Length Human CD177 Protein, GST-tagged | +Inquiry |
CD177-7807H | Recombinant Human CD177 protein, His-tagged | +Inquiry |
CD177-962HFL | Recombinant Full Length Human CD177 Protein, C-Flag-tagged | +Inquiry |
CD177-1437M | Recombinant Mouse CD177 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD177-320H | Active Recombinant Human CD177, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD177-778HCL | Recombinant Human CD177 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD177 Products
Required fields are marked with *
My Review for All CD177 Products
Required fields are marked with *
0
Inquiry Basket