Recombinant Full Length Human CD247 Protein
Cat.No. : | CD247-56HF |
Product Overview : | Recombinant full length protein of Human CD3 zeta with proprietary tag; Predicted MWt 43.76 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 164 amino acids |
Description : | The protein encoded by this gene is T-cell receptor zeta, which together with T-cell receptor alpha/beta and gamma/delta heterodimers, and with CD3-gamma, -delta and -epsilon, forms the T-cell receptor-CD3 complex. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. |
Form : | Liquid |
Molecular Mass : | 43.760kDa inclusive of tags |
AA Sequence : | MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | CD247 CD247 molecule [ Homo sapiens ] |
Official Symbol | CD247 |
Synonyms | CD247; CD247 molecule; CD3Z, CD3z antigen, zeta polypeptide (TiT3 complex) , CD247 antigen; T-cell surface glycoprotein CD3 zeta chain; CD3H; CD3Q |
Gene ID | 919 |
mRNA Refseq | NM_000734 |
Protein Refseq | NP_000725 |
MIM | 186780 |
UniProt ID | P20963 |
◆ Recombinant Proteins | ||
RFL36234OF | Recombinant Full Length Sheep T-Cell Surface Glycoprotein Cd3 Zeta Chain(Cd247) Protein, His-Tagged | +Inquiry |
CD247-3062M | Recombinant Mouse CD247 Protein | +Inquiry |
RFL24008HF | Recombinant Full Length Human T-Cell Surface Glycoprotein Cd3 Zeta Chain(Cd247) Protein, His-Tagged | +Inquiry |
CD247-10931H | Recombinant Human CD247, GST-tagged | +Inquiry |
CD247-56HF | Recombinant Full Length Human CD247 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD247-7679HCL | Recombinant Human CD247 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD247 Products
Required fields are marked with *
My Review for All CD247 Products
Required fields are marked with *