Recombinant Human CD247 Protein, GST-Tagged

Cat.No. : CD247-0757H
Product Overview : Human CD3Z full-length ORF (AAH25703, 1 a.a. - 164 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is T-cell receptor zeta, which together with T-cell receptor alpha/beta and gamma/delta heterodimers, and with CD3-gamma, -delta and -epsilon, forms the T-cell receptor-CD3 complex. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Molecular Mass : 43.78 kDa
AA Sequence : MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CD247 CD247 molecule [ Homo sapiens ]
Official Symbol CD247
Synonyms CD247; CD247 molecule; CD3Z, CD3z antigen, zeta polypeptide (TiT3 complex), CD247 antigen; T-cell surface glycoprotein CD3 zeta chain; CD3H; CD3Q; CD3zeta chain; TCR zeta chain; CD247 antigen, zeta subunit; T-cell receptor T3 zeta chain; CD3Z antigen, zeta polypeptide (TiT3 complex); T-cell antigen receptor complex, zeta subunit of CD3; T3Z; CD3Z; TCRZ; CD3-ZETA;
Gene ID 919
mRNA Refseq NM_000734
Protein Refseq NP_000725
MIM 186780
UniProt ID P20963

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD247 Products

Required fields are marked with *

My Review for All CD247 Products

Required fields are marked with *

0
cart-icon