Recombinant Human CD247 Protein, GST-Tagged
| Cat.No. : | CD247-0757H |
| Product Overview : | Human CD3Z full-length ORF (AAH25703, 1 a.a. - 164 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is T-cell receptor zeta, which together with T-cell receptor alpha/beta and gamma/delta heterodimers, and with CD3-gamma, -delta and -epsilon, forms the T-cell receptor-CD3 complex. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 43.78 kDa |
| AA Sequence : | MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CD247 CD247 molecule [ Homo sapiens ] |
| Official Symbol | CD247 |
| Synonyms | CD247; CD247 molecule; CD3Z, CD3z antigen, zeta polypeptide (TiT3 complex), CD247 antigen; T-cell surface glycoprotein CD3 zeta chain; CD3H; CD3Q; CD3zeta chain; TCR zeta chain; CD247 antigen, zeta subunit; T-cell receptor T3 zeta chain; CD3Z antigen, zeta polypeptide (TiT3 complex); T-cell antigen receptor complex, zeta subunit of CD3; T3Z; CD3Z; TCRZ; CD3-ZETA; |
| Gene ID | 919 |
| mRNA Refseq | NM_000734 |
| Protein Refseq | NP_000725 |
| MIM | 186780 |
| UniProt ID | P20963 |
| ◆ Recombinant Proteins | ||
| CD247-0757H | Recombinant Human CD247 Protein, GST-Tagged | +Inquiry |
| CD247-2726H | Recombinant Human CD247 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| RFL24008HF | Recombinant Full Length Human T-Cell Surface Glycoprotein Cd3 Zeta Chain(Cd247) Protein, His-Tagged | +Inquiry |
| CD247-56HF | Recombinant Full Length Human CD247 Protein | +Inquiry |
| CD247-3062M | Recombinant Mouse CD247 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD247-7679HCL | Recombinant Human CD247 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD247 Products
Required fields are marked with *
My Review for All CD247 Products
Required fields are marked with *
