Recombinant Human CD247 Protein, GST-Tagged
Cat.No. : | CD247-0757H |
Product Overview : | Human CD3Z full-length ORF (AAH25703, 1 a.a. - 164 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is T-cell receptor zeta, which together with T-cell receptor alpha/beta and gamma/delta heterodimers, and with CD3-gamma, -delta and -epsilon, forms the T-cell receptor-CD3 complex. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 43.78 kDa |
AA Sequence : | MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CD247 CD247 molecule [ Homo sapiens ] |
Official Symbol | CD247 |
Synonyms | CD247; CD247 molecule; CD3Z, CD3z antigen, zeta polypeptide (TiT3 complex), CD247 antigen; T-cell surface glycoprotein CD3 zeta chain; CD3H; CD3Q; CD3zeta chain; TCR zeta chain; CD247 antigen, zeta subunit; T-cell receptor T3 zeta chain; CD3Z antigen, zeta polypeptide (TiT3 complex); T-cell antigen receptor complex, zeta subunit of CD3; T3Z; CD3Z; TCRZ; CD3-ZETA; |
Gene ID | 919 |
mRNA Refseq | NM_000734 |
Protein Refseq | NP_000725 |
MIM | 186780 |
UniProt ID | P20963 |
◆ Recombinant Proteins | ||
CD247-536H | Recombinant Human CD247 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD247-3088HF | Recombinant Full Length Human CD247 Protein, GST-tagged | +Inquiry |
CD247-151H | Recombinant Human CD247 Protein, His-tagged | +Inquiry |
CD247-7091C | Recombinant Chicken CD247 | +Inquiry |
CD247-27869TH | Recombinant Human CD247 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD247-7679HCL | Recombinant Human CD247 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD247 Products
Required fields are marked with *
My Review for All CD247 Products
Required fields are marked with *
0
Inquiry Basket