Recombinant Full Length Human CD36 molecule (thrombospondin receptor) VLPs, GFP-tagged

Cat.No. : CD36-001HV
Product Overview : Recombinant Full Length Human CD36 VLPs with GFP-tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : EGFP
Protein Length : Full length
Description : The protein encoded by this gene is the fourth major glycoprotein of the platelet surface and serves as a receptor for thrombospondin in platelets and various cell lines. Since thrombospondins are widely distributed proteins involved in a variety of adhesive processes, this protein may have important functions as a cell adhesion molecule. It binds to collagen, thrombospondin, anionic phospholipids and oxidized LDL. It directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and it binds long chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport. Mutations in this gene cause platelet glycoprotein deficiency. Multiple alternatively spliced transcript variants have been found for this gene.
Tag : C-EGFP
AA Sequence : GCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK
Endotoxin : < 1 EU/μg by LAL.
Notes : Mix the sample gently by repeatedly pipetting it up and down. Do not vortex. Repeated freezing and thawing is not recommended.
The immunization strategy should be optimized (antigen dose, regimen and adjuvant).
Storage : Store it under sterile conditions at -20 to -80 centigrade twelve months from the date of receipt.
Storage Buffer : Lyophilized from a 0.2 μm sterile filtered PBS, 6 % Trehalose, pH 7.4. The volume before lyophilization is 82μl/vial.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80 centigrade.
Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vertexing.
Gene Name CD36 CD36 molecule (thrombospondin receptor) [Homo sapiens (human)]
Official Symbol CD36
Synonyms CD36; CD36 molecule (thrombospondin receptor); CD36 antigen (collagen type I receptor, thrombospondin receptor); platelet glycoprotein 4; FAT; GP3B; GP4; GPIV; SCARB3; GPIIIB; PAS IV; PAS-4 protein; glycoprotein IIIb; cluster determinant 36; fatty acid translocase; platelet glycoprotein IV; scavenger receptor class B, member 3; leukocyte differentiation antigen CD36; CHDS7; PASIV; BDPLT10
Gene ID 948
mRNA Refseq NM_000072
Protein Refseq NP_000063
MIM 173510
UniProt ID P16671

Not For Human Consumption!

Inquiry

  • Reviews (1)
  • Q&As (0)

Customer Reviews

Write a review
Reviews
01/25/2025
CD36-001HV

We did see some binding .. which was a lot better than other VLPs we purchased from other companies.

Ask a Question for All CD36 Products

Required fields are marked with *

My Review for All CD36 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon