Recombinant Full Length Human CEACAM4 Protein, C-Flag-tagged

Cat.No. : CEACAM4-1553HFL
Product Overview : Recombinant Full Length Human CEACAM4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : Involved in phagocytosis. Predicted to be located in extracellular region.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 25.7 kDa
AA Sequence : MGPPSAAPRGGHRPWQGLLITASLLTFWHPPTTVQFTIEALPSSAAEGKDVLLLACNISETIQAYYWHKG KTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSYTLRTINASYDSDQATGQLHV HQNNVPGLPVGAVAGIVTGVLVGVALVAALVCFLLLSRTGRASIQRDLREQPPPASTPGHGPSHRSTFSA
PLPSPRTATPIYEELLYSDANIYCQIDHKADVVSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Transmembrane
Full Length : Full L.
Gene Name CEACAM4 CEA cell adhesion molecule 4 [ Homo sapiens (human) ]
Official Symbol CEACAM4
Synonyms NCA; CGM7; CGM7_HUMAN
Gene ID 1089
mRNA Refseq NM_001817.4
Protein Refseq NP_001808.2
MIM 619159
UniProt ID O75871

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CEACAM4 Products

Required fields are marked with *

My Review for All CEACAM4 Products

Required fields are marked with *

0
cart-icon