Recombinant Full Length Human CEACAM4 Protein, C-Flag-tagged

• Cat.No.: CEACAM4-1553HFL
• Product Overview: Recombinant Full Length Human CEACAM4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: Involved in phagocytosis. Predicted to be located in extracellular region.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 25.7 kDa
• AA Sequence: MGPPSAAPRGGHRPWQGLLITASLLTFWHPPTTVQFTIEALPSSAAEGKDVLLLACNISETIQAYYWHKG KTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSYTLRTINASYDSDQATGQLHV HQNNVPGLPVGAVAGIVTGVLVGVALVAALVCFLLLSRTGRASIQRDLREQPPPASTPGHGPSHRSTFSA
  PLPSPRTATPIYEELLYSDANIYCQIDHKADVVSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Transmembrane
• Full Length: Full L.

Gene Information

• Gene Name: CEACAM4 CEA cell adhesion molecule 4 [ Homo sapiens (human) ]
• Official Symbol: CEACAM4
• Synonyms: NCA; CGM7; CGM7_HUMAN
• Gene ID: 1089
• mRNA Refseq: NM_001817.4
• Protein Refseq: NP_001808.2
• MIM: 619159
• UniProt ID: O75871