Recombinant Full Length Human CEACAM4 Protein, C-Flag-tagged
Cat.No. : | CEACAM4-1553HFL |
Product Overview : | Recombinant Full Length Human CEACAM4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Involved in phagocytosis. Predicted to be located in extracellular region. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 25.7 kDa |
AA Sequence : | MGPPSAAPRGGHRPWQGLLITASLLTFWHPPTTVQFTIEALPSSAAEGKDVLLLACNISETIQAYYWHKG KTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSYTLRTINASYDSDQATGQLHV HQNNVPGLPVGAVAGIVTGVLVGVALVAALVCFLLLSRTGRASIQRDLREQPPPASTPGHGPSHRSTFSA PLPSPRTATPIYEELLYSDANIYCQIDHKADVVSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | CEACAM4 CEA cell adhesion molecule 4 [ Homo sapiens (human) ] |
Official Symbol | CEACAM4 |
Synonyms | NCA; CGM7; CGM7_HUMAN |
Gene ID | 1089 |
mRNA Refseq | NM_001817.4 |
Protein Refseq | NP_001808.2 |
MIM | 619159 |
UniProt ID | O75871 |
◆ Recombinant Proteins | ||
CEACAM4-12H | Recombinant Human CEACAM4 protein, His-tagged | +Inquiry |
CEACAM4-571H | Recombinant Human CEACAM4 Protein, His (Fc)-Avi-tagged | +Inquiry |
CEACAM4-3193H | Recombinant Human CEACAM4 Protein, MYC/DDK-tagged | +Inquiry |
CEACAM4-2278H | Recombinant Human CEACAM4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CEACAM4-1356H | Recombinant Human CEACAM4 Protein (36-155 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CEACAM4 Products
Required fields are marked with *
My Review for All CEACAM4 Products
Required fields are marked with *
0
Inquiry Basket