Recombinant Full Length Human CHMP2B Protein, GST-tagged
Cat.No. : | CHMP2B-3206HF |
Product Overview : | Human CHMP2B full-length ORF (AAH01553.1, 1 a.a. - 213 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 213 amino acids |
Description : | This gene encodes a component of the heteromeric ESCRT-III complex (Endosomal Sorting Complex Required for Transport III) that functions in the recycling or degradation of cell surface receptors. ESCRT-III functions in the concentration and invagination of ubiquitinated endosomal cargos into intralumenal vesicles. The protein encoded by this gene is found as a monomer in the cytosol or as an oligomer in ESCRT-III complexes on endosomal membranes. It is expressed in neurons of all major regions of the brain. Mutations in this gene result in one form of familial frontotemporal lobar degeneration. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 49.17 kDa |
AA Sequence : | MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CHMP2B charged multivesicular body protein 2B [ Homo sapiens ] |
Official Symbol | CHMP2B |
Synonyms | CHMP2B; charged multivesicular body protein 2B; chromatin modifying protein 2B; charged multivesicular body protein 2b; CHMP2.5; DKFZP564O123; VPS2 homolog B (S. cerevisiae); VPS2B; VPS2 homolog B; vacuolar protein-sorting-associated protein 2-2; DMT1; VPS2-2; DKFZp564O123; |
Gene ID | 25978 |
mRNA Refseq | NM_001244644 |
Protein Refseq | NP_001231573 |
MIM | 609512 |
UniProt ID | Q9UQN3 |
◆ Recombinant Proteins | ||
CHMP2B-1651M | Recombinant Mouse CHMP2B Protein, His (Fc)-Avi-tagged | +Inquiry |
CHMP2B-3206HF | Recombinant Full Length Human CHMP2B Protein, GST-tagged | +Inquiry |
CHMP2B-4950H | Recombinant Human CHMP2B protein, GST-tagged | +Inquiry |
CHMP2B-1250H | Recombinant Human CHMP2B Protein, GST-Tagged | +Inquiry |
CHMP2B-5021H | Recombinant Human CHMP2B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHMP2B-185HCL | Recombinant Human CHMP2B lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHMP2B Products
Required fields are marked with *
My Review for All CHMP2B Products
Required fields are marked with *