Recombinant Full Length Human Claudin-7(Cldn7) Protein, His-Tagged
Cat.No. : | RFL1525HF |
Product Overview : | Recombinant Full Length Human Claudin-7(CLDN7) Protein (O95471) (1-211aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-211) |
Form : | Lyophilized powder |
AA Sequence : | MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTG MMSCKMYDSVLALSAALQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAM GGGIIFIVAGLAALVACSWYGHQIVTDFYNPLIPTNIKYEFGPAIFIGWAGSALVILGGA LLSCSCPGNESKAGYRVPRSYPKSNSSKEYV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CLDN7 |
Synonyms | CLDN7; CEPTRL2; CPETRL2; Claudin-7; CLDN-7 |
UniProt ID | O95471 |
◆ Recombinant Proteins | ||
CLDN7-028H | Recombinant Human CLDN7 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
RFL23007BF | Recombinant Full Length Bovine Claudin-7(Cldn7) Protein, His-Tagged | +Inquiry |
CLDN7-2062HF | Recombinant Full Length Human CLDN7 Protein, GST-tagged | +Inquiry |
CLDN7-1446H | Recombinant Human CLDN7 Protein, GST-tagged | +Inquiry |
CLDN7-3541M | Recombinant Mouse CLDN7 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLDN7-7459HCL | Recombinant Human CLDN7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLDN7 Products
Required fields are marked with *
My Review for All CLDN7 Products
Required fields are marked with *
0
Inquiry Basket