Recombinant Full Length Human CLEC2D Protein, GST-tagged
Cat.No. : | CLEC2D-2133HF |
Product Overview : | Human CLEC2D full-length ORF ( AAH19883, 1 a.a. - 154 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 154 amino acids |
Description : | This gene encodes a member of the natural killer cell receptor C-type lectin family. The encoded protein inhibits osteoclast formation and contains a transmembrane domain near the N-terminus as well as the C-type lectin-like extracellular domain. Several alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq, Oct 2010] |
Molecular Mass : | 42.68 kDa |
AA Sequence : | MHDSNNVEKDITPSELPANPGCVHSKEHSIKATLIWRLFFLIMFLTIIVCGMVAALSAIRANCHQEPSVCLQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQGQPWKWINGTEWTRQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CLEC2D C-type lectin domain family 2, member D [ Homo sapiens ] |
Official Symbol | CLEC2D |
Synonyms | CLEC2D; C-type lectin domain family 2, member D; C type lectin superfamily 2, member D; C-type lectin domain family 2 member D; C type lectin related f; CLAX; lectin like transcript 1; LLT1; OCIL; LLT-1; C-type lectin related f; lectin-like transcript 1; lectin-like NK cell receptor; osteoclast inhibitory lectin; C-type lectin superfamily 2, member D |
Gene ID | 29121 |
mRNA Refseq | NM_001004419 |
Protein Refseq | NP_001004419 |
MIM | 605659 |
UniProt ID | Q9UHP7 |
◆ Recombinant Proteins | ||
Clec2d-547R | Recombinant Rat Clec2d protein(Lys98-Leu233), hFc-tagged | +Inquiry |
CLEC2D-6077H | Recombinant Human CLEC2D Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CLEC2D-612HFL | Recombinant Full Length Human CLEC2D Protein, C-Flag-tagged | +Inquiry |
CLEC2D-328M | Recombinant Mouse CLEC2D protein, His-tagged | +Inquiry |
CLEC2D-1096R | Recombinant Rat CLEC2D Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLEC2D-737RCL | Recombinant Rat CLEC2D cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLEC2D Products
Required fields are marked with *
My Review for All CLEC2D Products
Required fields are marked with *