Recombinant Full Length Human CLEC2D Protein, GST-tagged

Cat.No. : CLEC2D-2133HF
Product Overview : Human CLEC2D full-length ORF ( AAH19883, 1 a.a. - 154 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 154 amino acids
Description : This gene encodes a member of the natural killer cell receptor C-type lectin family. The encoded protein inhibits osteoclast formation and contains a transmembrane domain near the N-terminus as well as the C-type lectin-like extracellular domain. Several alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq, Oct 2010]
Molecular Mass : 42.68 kDa
AA Sequence : MHDSNNVEKDITPSELPANPGCVHSKEHSIKATLIWRLFFLIMFLTIIVCGMVAALSAIRANCHQEPSVCLQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQGQPWKWINGTEWTRQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CLEC2D C-type lectin domain family 2, member D [ Homo sapiens ]
Official Symbol CLEC2D
Synonyms CLEC2D; C-type lectin domain family 2, member D; C type lectin superfamily 2, member D; C-type lectin domain family 2 member D; C type lectin related f; CLAX; lectin like transcript 1; LLT1; OCIL; LLT-1; C-type lectin related f; lectin-like transcript 1; lectin-like NK cell receptor; osteoclast inhibitory lectin; C-type lectin superfamily 2, member D
Gene ID 29121
mRNA Refseq NM_001004419
Protein Refseq NP_001004419
MIM 605659
UniProt ID Q9UHP7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLEC2D Products

Required fields are marked with *

My Review for All CLEC2D Products

Required fields are marked with *

0
cart-icon
0
compare icon