Recombinant Full Length Human CLIC1 Protein, GST-tagged
Cat.No. : | CLIC1-2175HF |
Product Overview : | Human CLIC1 full-length ORF ( AAH64527.1, 1 a.a. - 241 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 241 amino acids |
Description : | Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 1 is a member of the p64 family; the protein localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 52.25 kDa |
AA Sequence : | MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSSPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CLIC1 chloride intracellular channel 1 [ Homo sapiens ] |
Official Symbol | CLIC1 |
Synonyms | CLIC1; chloride intracellular channel 1; chloride intracellular channel protein 1; NCC27; p64CLCP; hRNCC; RNCC protein; chloride channel ABP; nuclear chloride ion channel 27; nuclear chloride ion channel protein; regulatory nuclear chloride ion channel protein; G6 |
Gene ID | 1192 |
mRNA Refseq | NM_001288 |
Protein Refseq | NP_001279 |
MIM | 602872 |
UniProt ID | O00299 |
◆ Recombinant Proteins | ||
CLIC1-2498H | Recombinant Human Chloride Intracellular Channel 1, His-tagged | +Inquiry |
RFL17585SF | Recombinant Full Length Pig Chloride Intracellular Channel Protein 1(Clic1) Protein, His-Tagged | +Inquiry |
CLIC1-5937H | Recombinant Human CLIC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Clic1-519M | Recombinant Mouse Clic1 Protein, MYC/DDK-tagged | +Inquiry |
CLIC1-11958Z | Recombinant Zebrafish CLIC1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLIC1-7448HCL | Recombinant Human CLIC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLIC1 Products
Required fields are marked with *
My Review for All CLIC1 Products
Required fields are marked with *
0
Inquiry Basket