Recombinant Full Length Human CLIC1 Protein, GST-tagged
| Cat.No. : | CLIC1-2175HF | 
| Product Overview : | Human CLIC1 full-length ORF ( AAH64527.1, 1 a.a. - 241 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 241 amino acids | 
| Description : | Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 1 is a member of the p64 family; the protein localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity. [provided by RefSeq, Jul 2008] | 
| Molecular Mass : | 52.25 kDa | 
| AA Sequence : | MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSSPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | CLIC1 chloride intracellular channel 1 [ Homo sapiens ] | 
| Official Symbol | CLIC1 | 
| Synonyms | CLIC1; chloride intracellular channel 1; chloride intracellular channel protein 1; NCC27; p64CLCP; hRNCC; RNCC protein; chloride channel ABP; nuclear chloride ion channel 27; nuclear chloride ion channel protein; regulatory nuclear chloride ion channel protein; G6 | 
| Gene ID | 1192 | 
| mRNA Refseq | NM_001288 | 
| Protein Refseq | NP_001279 | 
| MIM | 602872 | 
| UniProt ID | O00299 | 
| ◆ Recombinant Proteins | ||
| CLIC1-5937H | Recombinant Human CLIC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| RFL24437BF | Recombinant Full Length Bovine Chloride Intracellular Channel Protein 1(Clic1) Protein, His-Tagged | +Inquiry | 
| CLIC1-2175HF | Recombinant Full Length Human CLIC1 Protein, GST-tagged | +Inquiry | 
| CLIC1-262H | Recombinant Human CLIC1, His-tagged | +Inquiry | 
| CLIC1-1448R | Recombinant Rat CLIC1 Protein | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CLIC1-7448HCL | Recombinant Human CLIC1 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLIC1 Products
Required fields are marked with *
My Review for All CLIC1 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            