Recombinant Full Length Human CXCL16 Protein, GST-tagged
Cat.No. : | CXCL16-2286HF |
Product Overview : | Human CXCL16 full-length ORF ( AAH17588, 49 a.a. - 273 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 49-273 amino acids |
Description : | CXCL16 (C-X-C Motif Chemokine Ligand 16) is a Protein Coding gene. Diseases associated with CXCL16 include Xanthogranulomatous Cholecystitis. Among its related pathways arePeptide ligand-binding receptors and Chemokine Superfamily Pathway: Human/Mouse Ligand-Receptor Interactions. GO annotations related to this gene include chemokine activity andlow-density lipoprotein receptor activity. |
Molecular Mass : | 50.49 kDa |
AA Sequence : | NEGSVTGSCYCGKRISSDSPPSVQFMNRLRKHLRAYHRCLYYTRFQLLSWSVCGGNKDPWVQELMSCLDLKECGHAYSGIVAHQKHLLPTSPPISQASEGASSDIHTPAQMLLSTLQSTQRPTLPVGSLSSDKELTRPNETTIHTAGHSLAAGPEAGENQKQPEKNAGPTARTSATVPVLCLLAIIFILTAALSYVLCKRRRGQSPQSSPDLPVHYIPVAPDSNT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CXCL16 chemokine (C-X-C motif) ligand 16 [ Homo sapiens ] |
Official Symbol | CXCL16 |
Synonyms | CXCL16; chemokine (C-X-C motif) ligand 16; C-X-C motif chemokine 16; CXC chemokine ligand 16; CXCLG16; SR PSOX; SRPSOX; small-inducible cytokine B16; transmembrane chemokine CXCL16; scavenger receptor for phosphatidylserine and oxidized low density lipoprotein; SR-PSOX |
Gene ID | 58191 |
mRNA Refseq | NM_001100812 |
Protein Refseq | NP_001094282 |
MIM | 605398 |
UniProt ID | Q9H2A7 |
◆ Recombinant Proteins | ||
Cxcl16-883M | Recombinant Mouse Cxcl16 Protein, His-tagged | +Inquiry |
Cxcl16-85M | Recombinant Mouse Cxcl16 protein | +Inquiry |
CXCL16-7648H | Recombinant Human CXCL16 protein, His & T7-tagged | +Inquiry |
Cxcl16-5253M | Recombinant Mouse Cxcl16 protein, His-tagged | +Inquiry |
CXCL16-34H | Recombinant Human CXCL16 Protein, Biotin-tagged | +Inquiry |
◆ Native Proteins | ||
CXCL16-253C | Recombinant Cynomolgus CXCL16 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL16-1414RCL | Recombinant Rat CXCL16 cell lysate | +Inquiry |
CXCL16-2545MCL | Recombinant Mouse CXCL16 cell lysate | +Inquiry |
CXCL16-842CCL | Recombinant Canine CXCL16 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CXCL16 Products
Required fields are marked with *
My Review for All CXCL16 Products
Required fields are marked with *
0
Inquiry Basket