Recombinant Full Length Human DCP2 Protein, GST-tagged
| Cat.No. : | DCP2-2893HF |
| Product Overview : | Human DCP2 full-length ORF ( AAH64593, 1 a.a. - 385 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 385 amino acids |
| Description : | The protein encoded by this gene is a key component of an mRNA-decapping complex required for degradation of mRNAs, both in normal mRNA turnover, and in nonsense-mediated mRNA decay (NMD). It removes the 7-methyl guanine cap structure from mRNA, prior to its degradation from the 5' end. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.[provided by RefSeq, Jun 2011] |
| Molecular Mass : | 68.09 kDa |
| AA Sequence : | METKRVEIPGSVLDDLCSRFILHIPSEERDNAIRVCFQIELAHWFYLDFYMQNTPGLPQCGIRDFAKAVFSHCPFLLPQGEDVEKVLDEWKEYKMGVPTYGAIILDETLENVLLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGIPKDTKFNPKTRREIRNIEWFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWLSRRFGDSSDSDNGFSSTGSTPAKPTVEKLSRTKFRHSQQLFPDGSPGDQWVKHRQPLQQKPYNNHSEMSDLLKGKKCEKKLHPRKLQDNFETDAVYDLPSSSEDQLLEHAEGQPVACNGHCKFPFSSRAFLSFKFDHNAIMKILDL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | DCP2 |
| Synonyms | DCP2; DCP2 decapping enzyme homolog (S. cerevisiae); mRNA-decapping enzyme 2; nudix (nucleoside diphosphate linked moiety X) type motif 20; NUDT20; hDpc; nudix (nucleoside diphosphate linked moiety X)-type motif 20; FLJ33245; |
| Gene ID | 167227 |
| mRNA Refseq | NM_001242377 |
| Protein Refseq | NP_001229306 |
| MIM | 609844 |
| UniProt ID | Q8IU60 |
| ◆ Recombinant Proteins | ||
| DCP2-2893HF | Recombinant Full Length Human DCP2 Protein, GST-tagged | +Inquiry |
| DCP2-1690H | Recombinant Human DCP2 Protein (1-385 aa), His-tagged | +Inquiry |
| DCP2-1570H | Recombinant Human DCP2 protein | +Inquiry |
| DCP2-1018R | Recombinant Rhesus Macaque DCP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DCP2-11861H | Recombinant Human DCP2 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DCP2-446HCL | Recombinant Human DCP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DCP2 Products
Required fields are marked with *
My Review for All DCP2 Products
Required fields are marked with *
