Recombinant Full Length Human DCP2 Protein, GST-tagged

Cat.No. : DCP2-2893HF
Product Overview : Human DCP2 full-length ORF ( AAH64593, 1 a.a. - 385 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 385 amino acids
Description : The protein encoded by this gene is a key component of an mRNA-decapping complex required for degradation of mRNAs, both in normal mRNA turnover, and in nonsense-mediated mRNA decay (NMD). It removes the 7-methyl guanine cap structure from mRNA, prior to its degradation from the 5' end. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.[provided by RefSeq, Jun 2011]
Molecular Mass : 68.09 kDa
AA Sequence : METKRVEIPGSVLDDLCSRFILHIPSEERDNAIRVCFQIELAHWFYLDFYMQNTPGLPQCGIRDFAKAVFSHCPFLLPQGEDVEKVLDEWKEYKMGVPTYGAIILDETLENVLLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGIPKDTKFNPKTRREIRNIEWFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWLSRRFGDSSDSDNGFSSTGSTPAKPTVEKLSRTKFRHSQQLFPDGSPGDQWVKHRQPLQQKPYNNHSEMSDLLKGKKCEKKLHPRKLQDNFETDAVYDLPSSSEDQLLEHAEGQPVACNGHCKFPFSSRAFLSFKFDHNAIMKILDL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DCP2 DCP2 decapping enzyme homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol DCP2
Synonyms DCP2; DCP2 decapping enzyme homolog (S. cerevisiae); mRNA-decapping enzyme 2; nudix (nucleoside diphosphate linked moiety X) type motif 20; NUDT20; hDpc; nudix (nucleoside diphosphate linked moiety X)-type motif 20; FLJ33245;
Gene ID 167227
mRNA Refseq NM_001242377
Protein Refseq NP_001229306
MIM 609844
UniProt ID Q8IU60

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DCP2 Products

Required fields are marked with *

My Review for All DCP2 Products

Required fields are marked with *

0
cart-icon